BLASTX nr result
ID: Ophiopogon27_contig00020500
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00020500 (356 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020242396.1| LOW QUALITY PROTEIN: uncharacterized protein... 55 2e-06 gb|EIC79303.1| gram positive anchor [Streptococcus oralis SK10] ... 54 5e-06 ref|WP_080568482.1| hypothetical protein [Streptococcus oralis] 54 5e-06 >ref|XP_020242396.1| LOW QUALITY PROTEIN: uncharacterized protein LOC109820629 [Asparagus officinalis] Length = 230 Score = 54.7 bits (130), Expect = 2e-06 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -3 Query: 354 AYSNALLIDPSIRRSKLFKARVAKLNEELILSSAPS 247 AYSNALLIDPSIRRSK FKA+V KL E+L++S A S Sbjct: 195 AYSNALLIDPSIRRSKSFKAKVTKLQEKLVVSDASS 230 >gb|EIC79303.1| gram positive anchor [Streptococcus oralis SK10] gb|KZX06613.1| hypothetical protein A4221_01580 [Streptococcus oralis] Length = 367 Score = 54.3 bits (129), Expect = 5e-06 Identities = 31/67 (46%), Positives = 41/67 (61%), Gaps = 1/67 (1%) Frame = +3 Query: 18 KPEGS-KNSEDAKPDSPPKSCEDVKRDTAAEKLEGQGLEDAEPASPPKGSEDVKLASSPK 194 KPE S K +ED KP++P K EDVK +T + +E + +P SP K +EDVK + K Sbjct: 138 KPETSTKPAEDVKPETPAKPVEDVKPETPTKPVE-----EVKPESPTKPAEDVKPVTPAK 192 Query: 195 GTEDVKP 215 EDVKP Sbjct: 193 PVEDVKP 199 >ref|WP_080568482.1| hypothetical protein [Streptococcus oralis] Length = 400 Score = 54.3 bits (129), Expect = 5e-06 Identities = 31/67 (46%), Positives = 41/67 (61%), Gaps = 1/67 (1%) Frame = +3 Query: 18 KPEGS-KNSEDAKPDSPPKSCEDVKRDTAAEKLEGQGLEDAEPASPPKGSEDVKLASSPK 194 KPE S K +ED KP++P K EDVK +T + +E + +P SP K +EDVK + K Sbjct: 171 KPETSTKPAEDVKPETPAKPVEDVKPETPTKPVE-----EVKPESPTKPAEDVKPVTPAK 225 Query: 195 GTEDVKP 215 EDVKP Sbjct: 226 PVEDVKP 232