BLASTX nr result
ID: Ophiopogon27_contig00020488
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00020488 (471 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020268228.1| mitochondrial import receptor subunit TOM7-1... 97 1e-23 ref|XP_009389359.1| PREDICTED: mitochondrial import receptor sub... 90 1e-20 ref|XP_009416416.1| PREDICTED: mitochondrial import receptor sub... 89 2e-20 ref|XP_008810028.1| PREDICTED: mitochondrial import receptor sub... 88 4e-20 ref|XP_003530621.1| PREDICTED: mitochondrial import receptor sub... 88 6e-20 ref|XP_003525317.1| PREDICTED: mitochondrial import receptor sub... 87 8e-20 gb|OVA19284.1| Mitochondrial import receptor subunit TOM7 [Macle... 87 1e-19 ref|XP_007225789.1| mitochondrial import receptor subunit TOM7-1... 87 1e-19 ref|XP_022009339.1| mitochondrial import receptor subunit TOM7-1... 87 2e-19 gb|AFK44684.1| unknown [Lotus japonicus] 86 2e-19 ref|XP_012463735.1| PREDICTED: mitochondrial import receptor sub... 86 3e-19 ref|XP_016675737.1| PREDICTED: mitochondrial import receptor sub... 86 3e-19 ref|XP_009406780.1| PREDICTED: mitochondrial import receptor sub... 86 3e-19 gb|AAS21011.1| unknown [Hyacinthus orientalis] 86 3e-19 ref|XP_021632247.1| mitochondrial import receptor subunit TOM7-1... 86 3e-19 ref|XP_015384248.1| PREDICTED: mitochondrial import receptor sub... 86 4e-19 ref|XP_011077684.1| mitochondrial import receptor subunit TOM7-1... 86 5e-19 ref|XP_011077105.1| mitochondrial import receptor subunit TOM7-1... 86 5e-19 ref|XP_019705947.1| PREDICTED: mitochondrial import receptor sub... 85 6e-19 ref|XP_006434604.1| mitochondrial import receptor subunit TOM7-1... 85 6e-19 >ref|XP_020268228.1| mitochondrial import receptor subunit TOM7-1 [Asparagus officinalis] Length = 73 Score = 97.4 bits (241), Expect = 1e-23 Identities = 44/48 (91%), Positives = 45/48 (93%) Frame = +1 Query: 109 YAKCAKEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPTLSQLLSPV 252 Y KC KEWTTWAMKKAKV THYGFIPLIIVIGMN+EPKPTLSQLLSPV Sbjct: 26 YGKCVKEWTTWAMKKAKVVTHYGFIPLIIVIGMNSEPKPTLSQLLSPV 73 >ref|XP_009389359.1| PREDICTED: mitochondrial import receptor subunit TOM7-2-like [Musa acuminata subsp. malaccensis] Length = 73 Score = 89.7 bits (221), Expect = 1e-20 Identities = 41/47 (87%), Positives = 43/47 (91%) Frame = +1 Query: 112 AKCAKEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPTLSQLLSPV 252 AKC KEW+TWAMKKAKV THYGFIPLIIVIGMN+EPKP L QLLSPV Sbjct: 27 AKCVKEWSTWAMKKAKVITHYGFIPLIIVIGMNSEPKPQLYQLLSPV 73 >ref|XP_009416416.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Musa acuminata subsp. malaccensis] Length = 71 Score = 89.0 bits (219), Expect = 2e-20 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = +1 Query: 112 AKCAKEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPTLSQLLSPV 252 AKC KEW+TWAMKKAKV THYGFIPLI++IGMN+EPKP L QLLSPV Sbjct: 25 AKCVKEWSTWAMKKAKVITHYGFIPLIVIIGMNSEPKPQLYQLLSPV 71 >ref|XP_008810028.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Phoenix dactylifera] Length = 72 Score = 88.2 bits (217), Expect = 4e-20 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = +1 Query: 112 AKCAKEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPTLSQLLSPV 252 A+C K W+TWAMKKAKV THYGFIPLII+IGMN+EPKP LSQLLSPV Sbjct: 26 ARCVKTWSTWAMKKAKVITHYGFIPLIIIIGMNSEPKPQLSQLLSPV 72 >ref|XP_003530621.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Glycine max] gb|KHN16697.1| Mitochondrial import receptor subunit TOM7-1 [Glycine soja] gb|KRH41405.1| hypothetical protein GLYMA_08G027900 [Glycine max] Length = 72 Score = 87.8 bits (216), Expect = 6e-20 Identities = 38/47 (80%), Positives = 44/47 (93%) Frame = +1 Query: 112 AKCAKEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPTLSQLLSPV 252 ++C KEWTTWAM+KAKV THYGFIPL+IVIGMN++PKP LSQLLSPV Sbjct: 26 SECLKEWTTWAMRKAKVITHYGFIPLVIVIGMNSDPKPPLSQLLSPV 72 >ref|XP_003525317.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Glycine max] gb|KHM99855.1| Mitochondrial import receptor subunit TOM7-1 [Glycine soja] gb|KRH60119.1| hypothetical protein GLYMA_05G2214001 [Glycine max] Length = 72 Score = 87.4 bits (215), Expect = 8e-20 Identities = 37/47 (78%), Positives = 44/47 (93%) Frame = +1 Query: 112 AKCAKEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPTLSQLLSPV 252 ++C KEWTTWAM+KAKV THYGFIPL+I+IGMN++PKP LSQLLSPV Sbjct: 26 SECLKEWTTWAMRKAKVITHYGFIPLVIIIGMNSDPKPPLSQLLSPV 72 >gb|OVA19284.1| Mitochondrial import receptor subunit TOM7 [Macleaya cordata] Length = 71 Score = 87.0 bits (214), Expect = 1e-19 Identities = 36/46 (78%), Positives = 43/46 (93%) Frame = +1 Query: 115 KCAKEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPTLSQLLSPV 252 KC KEW+TWAMKKAKV THYGFIPL+I+IGMN+EPKP L+QL+SP+ Sbjct: 26 KCLKEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPQLAQLISPI 71 >ref|XP_007225789.1| mitochondrial import receptor subunit TOM7-1 [Prunus persica] ref|XP_008223958.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Prunus mume] ref|XP_021825143.1| mitochondrial import receptor subunit TOM7-1 [Prunus avium] gb|ONI27067.1| hypothetical protein PRUPE_1G065700 [Prunus persica] Length = 73 Score = 87.0 bits (214), Expect = 1e-19 Identities = 40/47 (85%), Positives = 43/47 (91%) Frame = +1 Query: 112 AKCAKEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPTLSQLLSPV 252 A+ KEW+TWAMKKAKV THYGFIPLIIVIGMN+EPKP LSQLLSPV Sbjct: 27 AQSVKEWSTWAMKKAKVVTHYGFIPLIIVIGMNSEPKPQLSQLLSPV 73 >ref|XP_022009339.1| mitochondrial import receptor subunit TOM7-1-like [Helianthus annuus] gb|OTF97696.1| putative outer membrane translocase complex, subunit Tom7 [Helianthus annuus] Length = 73 Score = 86.7 bits (213), Expect = 2e-19 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = +1 Query: 112 AKCAKEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPTLSQLLSPV 252 +K KEWTTW MKKAKV THYGFIPLII IGMN+EPKPT+SQLLSPV Sbjct: 27 SKVLKEWTTWTMKKAKVVTHYGFIPLIIFIGMNSEPKPTISQLLSPV 73 >gb|AFK44684.1| unknown [Lotus japonicus] Length = 72 Score = 86.3 bits (212), Expect = 2e-19 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = +1 Query: 115 KCAKEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPTLSQLLSPV 252 +C KEWTTW M+KAKV THYGFIPLII+IGMN++PKP LSQLLSPV Sbjct: 27 ECLKEWTTWTMRKAKVVTHYGFIPLIIIIGMNSDPKPQLSQLLSPV 72 >ref|XP_012463735.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Gossypium raimondii] ref|XP_012463736.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Gossypium raimondii] gb|KJB81174.1| hypothetical protein B456_013G132400 [Gossypium raimondii] gb|KJB81175.1| hypothetical protein B456_013G132400 [Gossypium raimondii] gb|PPD94483.1| hypothetical protein GOBAR_DD08498 [Gossypium barbadense] Length = 72 Score = 85.9 bits (211), Expect = 3e-19 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = +1 Query: 115 KCAKEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPTLSQLLSPV 252 +C KEW+TWAMKKAKV THYGFIPL+I+IGMN+EPKP L QLLSPV Sbjct: 27 QCLKEWSTWAMKKAKVVTHYGFIPLVIIIGMNSEPKPQLYQLLSPV 72 >ref|XP_016675737.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Gossypium hirsutum] ref|XP_016703287.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Gossypium hirsutum] ref|XP_017608704.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Gossypium arboreum] gb|KHG28073.1| Mitochondrial import receptor subunit TOM7-1 -like protein [Gossypium arboreum] gb|PPR94623.1| hypothetical protein GOBAR_AA26047 [Gossypium barbadense] Length = 72 Score = 85.9 bits (211), Expect = 3e-19 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = +1 Query: 115 KCAKEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPTLSQLLSPV 252 +C KEW+TWAMKKAKV THYGFIPL+I+IGMN+EPKP L QLLSPV Sbjct: 27 QCLKEWSTWAMKKAKVVTHYGFIPLVIIIGMNSEPKPQLYQLLSPV 72 >ref|XP_009406780.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Musa acuminata subsp. malaccensis] ref|XP_018682998.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Musa acuminata subsp. malaccensis] Length = 72 Score = 85.9 bits (211), Expect = 3e-19 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = +1 Query: 115 KCAKEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPTLSQLLSPV 252 KC KEW+TWAMKKAKV THYGFIPLII IGMN+EPKP L QLLSPV Sbjct: 27 KCFKEWSTWAMKKAKVITHYGFIPLIITIGMNSEPKPQLYQLLSPV 72 >gb|AAS21011.1| unknown [Hyacinthus orientalis] Length = 72 Score = 85.9 bits (211), Expect = 3e-19 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +1 Query: 124 KEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPTLSQLLSP 249 KEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPT QL+SP Sbjct: 30 KEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPTFYQLVSP 71 >ref|XP_021632247.1| mitochondrial import receptor subunit TOM7-1-like [Manihot esculenta] gb|OAY33764.1| hypothetical protein MANES_13G122700 [Manihot esculenta] Length = 74 Score = 85.9 bits (211), Expect = 3e-19 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = +1 Query: 115 KCAKEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPTLSQLLSPV 252 +C KEW+TWAMKKAKV THYGFIPL+I+IGMN+EPKP L QLLSPV Sbjct: 29 QCLKEWSTWAMKKAKVVTHYGFIPLVIIIGMNSEPKPQLYQLLSPV 74 >ref|XP_015384248.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Citrus sinensis] gb|KDO83900.1| hypothetical protein CISIN_1g035165mg [Citrus sinensis] gb|KDO83901.1| hypothetical protein CISIN_1g035165mg [Citrus sinensis] Length = 71 Score = 85.5 bits (210), Expect = 4e-19 Identities = 37/47 (78%), Positives = 42/47 (89%) Frame = +1 Query: 112 AKCAKEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPTLSQLLSPV 252 A C KEW+TWAMKKAKV THYGFIPL+I+IGMN++PKP L QLLSPV Sbjct: 25 ADCLKEWSTWAMKKAKVITHYGFIPLVIIIGMNSDPKPQLHQLLSPV 71 >ref|XP_011077684.1| mitochondrial import receptor subunit TOM7-1-like [Sesamum indicum] Length = 78 Score = 85.5 bits (210), Expect = 5e-19 Identities = 37/47 (78%), Positives = 43/47 (91%) Frame = +1 Query: 112 AKCAKEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPTLSQLLSPV 252 AK KEW+TW MKKAKV THYGFIP++I+IGMN+EPKP+LSQLLSPV Sbjct: 32 AKFVKEWSTWTMKKAKVITHYGFIPMVIIIGMNSEPKPSLSQLLSPV 78 >ref|XP_011077105.1| mitochondrial import receptor subunit TOM7-1-like [Sesamum indicum] Length = 78 Score = 85.5 bits (210), Expect = 5e-19 Identities = 37/47 (78%), Positives = 43/47 (91%) Frame = +1 Query: 112 AKCAKEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPTLSQLLSPV 252 AK KEW+TW MKKAKV THYGFIP++I+IGMN+EPKP+LSQLLSPV Sbjct: 32 AKFVKEWSTWTMKKAKVITHYGFIPMVIIIGMNSEPKPSLSQLLSPV 78 >ref|XP_019705947.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Elaeis guineensis] Length = 69 Score = 85.1 bits (209), Expect = 6e-19 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = +1 Query: 112 AKCAKEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPTLSQLLSPV 252 A+ K+W+TWAMKKAKV THYGFIPLII+IGMN+EPKP LSQLLSPV Sbjct: 23 ARSVKKWSTWAMKKAKVITHYGFIPLIIIIGMNSEPKPQLSQLLSPV 69 >ref|XP_006434604.1| mitochondrial import receptor subunit TOM7-1 [Citrus clementina] ref|XP_024040722.1| mitochondrial import receptor subunit TOM7-1 [Citrus clementina] gb|ESR47843.1| hypothetical protein CICLE_v10003057mg [Citrus clementina] gb|ESR47844.1| hypothetical protein CICLE_v10003057mg [Citrus clementina] Length = 71 Score = 85.1 bits (209), Expect = 6e-19 Identities = 37/47 (78%), Positives = 42/47 (89%) Frame = +1 Query: 112 AKCAKEWTTWAMKKAKVATHYGFIPLIIVIGMNTEPKPTLSQLLSPV 252 A C KEW+TWAMKKAKV THYGFIPL+I+IGMN++PKP L QLLSPV Sbjct: 25 ADCLKEWSTWAMKKAKVITHYGFIPLVIIIGMNSDPKPQLYQLLSPV 71