BLASTX nr result
ID: Ophiopogon27_contig00020053
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00020053 (473 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020262670.1| hsp70 nucleotide exchange factor FES1 [Aspar... 55 8e-06 >ref|XP_020262670.1| hsp70 nucleotide exchange factor FES1 [Asparagus officinalis] gb|ONK72142.1| uncharacterized protein A4U43_C04F16220 [Asparagus officinalis] Length = 432 Score = 55.1 bits (131), Expect = 8e-06 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -1 Query: 473 EQFERLTRVEEHGDYARELEDLRREVYTIFRRKLEK 366 EQ E+L +EEH DYARELE LR EVYTIF +KLEK Sbjct: 391 EQLEKLRTLEEHKDYARELEGLREEVYTIFHQKLEK 426