BLASTX nr result
ID: Ophiopogon27_contig00019690
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00019690 (351 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020247268.1| regulation of nuclear pre-mRNA domain-contai... 60 3e-08 >ref|XP_020247268.1| regulation of nuclear pre-mRNA domain-containing protein 1B [Asparagus officinalis] gb|ONK56141.1| uncharacterized protein A4U43_C10F4560 [Asparagus officinalis] Length = 444 Score = 60.5 bits (145), Expect = 3e-08 Identities = 36/105 (34%), Positives = 43/105 (40%) Frame = +2 Query: 35 SYVFSCLAPEGITSQSMSEDRPSDTSKRPRLNNGSLGNAPCFXXXXXXXXXXXXXXXXXX 214 SYV S L +G+ Q SE+ D SKRPRLNNG+LG+ PCF Sbjct: 334 SYVLSSLVSDGVIGQPTSEEDHPDASKRPRLNNGNLGSVPCFLPQPMLSPTLPL------ 387 Query: 215 XXXXXXXXXXXXXXXXXXXXXXVAGSMSVPPFSYGSPPLQPMPGF 349 V PF+YG PP+ PMPGF Sbjct: 388 ----------------------------VTPFTYGPPPVPPMPGF 404