BLASTX nr result
ID: Ophiopogon27_contig00019457
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00019457 (466 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK81035.1| uncharacterized protein A4U43_C01F24540 [Asparagu... 68 2e-10 ref|XP_020251304.1| 2-alkenal reductase (NADP(+)-dependent)-like... 67 6e-10 ref|XP_019078346.1| PREDICTED: 2-alkenal reductase (NADP(+)-depe... 66 1e-09 ref|XP_002265626.1| PREDICTED: 2-alkenal reductase (NADP(+)-depe... 66 1e-09 emb|CDP09537.1| unnamed protein product [Coffea canephora] 64 7e-09 gb|PIA50039.1| hypothetical protein AQUCO_01300639v1 [Aquilegia ... 64 8e-09 ref|XP_021817725.1| 2-alkenal reductase (NADP(+)-dependent)-like... 63 1e-08 ref|XP_008242765.1| PREDICTED: 2-alkenal reductase (NADP(+)-depe... 63 1e-08 ref|XP_010914867.1| PREDICTED: 2-alkenal reductase (NADP(+)-depe... 62 2e-08 emb|CDP09536.1| unnamed protein product [Coffea canephora] 62 2e-08 ref|XP_010914866.1| PREDICTED: 2-alkenal reductase (NADP(+)-depe... 62 2e-08 gb|KZN00434.1| hypothetical protein DCAR_009188 [Daucus carota s... 62 2e-08 ref|XP_017241037.1| PREDICTED: 2-alkenal reductase (NADP(+)-depe... 62 2e-08 gb|OIT39357.1| nadp-dependent alkenal double bond reductase p1 [... 62 2e-08 gb|EEF37924.1| alcohol dehydrogenase, putative [Ricinus communis] 57 2e-08 gb|PHU21411.1| hypothetical protein BC332_06518 [Capsicum chinense] 59 2e-08 gb|PHT57632.1| hypothetical protein T459_35396 [Capsicum annuum] 59 2e-08 ref|XP_019189486.1| PREDICTED: NADP-dependent alkenal double bon... 62 3e-08 emb|CBI28191.3| unnamed protein product, partial [Vitis vinifera] 62 3e-08 ref|XP_017255913.1| PREDICTED: 2-alkenal reductase (NADP(+)-depe... 62 3e-08 >gb|ONK81035.1| uncharacterized protein A4U43_C01F24540 [Asparagus officinalis] Length = 342 Score = 67.8 bits (164), Expect = 2e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = +1 Query: 1 HVLEDISHGIESVPSAFAGLFRGDNLGKKIVKVAD 105 HVLEDISHG+E+ PSAFAGLFRGDN+GKKI+KVAD Sbjct: 300 HVLEDISHGLETAPSAFAGLFRGDNVGKKIIKVAD 334 >ref|XP_020251304.1| 2-alkenal reductase (NADP(+)-dependent)-like [Asparagus officinalis] ref|XP_020251305.1| 2-alkenal reductase (NADP(+)-dependent)-like [Asparagus officinalis] gb|ONK81040.1| uncharacterized protein A4U43_C01F24590 [Asparagus officinalis] Length = 351 Score = 66.6 bits (161), Expect = 6e-10 Identities = 30/35 (85%), Positives = 35/35 (100%) Frame = +1 Query: 1 HVLEDISHGIESVPSAFAGLFRGDNLGKKIVKVAD 105 HVLEDIS+G+E+VPSAFAGLFRGDN+GKKIVK+AD Sbjct: 311 HVLEDISYGLENVPSAFAGLFRGDNIGKKIVKLAD 345 >ref|XP_019078346.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent) isoform X2 [Vitis vinifera] Length = 347 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +1 Query: 1 HVLEDISHGIESVPSAFAGLFRGDNLGKKIVKVAD 105 HVLEDIS G+ES+PSAF GLFRGDN+GKK+VKVAD Sbjct: 312 HVLEDISQGVESIPSAFVGLFRGDNVGKKVVKVAD 346 >ref|XP_002265626.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent) isoform X1 [Vitis vinifera] emb|CBI17880.3| unnamed protein product, partial [Vitis vinifera] Length = 347 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +1 Query: 1 HVLEDISHGIESVPSAFAGLFRGDNLGKKIVKVAD 105 HVLEDIS G+ES+PSAF GLFRGDN+GKK+VKVAD Sbjct: 312 HVLEDISQGVESIPSAFVGLFRGDNVGKKVVKVAD 346 >emb|CDP09537.1| unnamed protein product [Coffea canephora] Length = 346 Score = 63.5 bits (153), Expect = 7e-09 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = +1 Query: 4 VLEDISHGIESVPSAFAGLFRGDNLGKKIVKVAD 105 VLEDISHG+ES+PSAF GLFRGDN+GKK+V+VAD Sbjct: 312 VLEDISHGLESIPSAFVGLFRGDNMGKKMVQVAD 345 >gb|PIA50039.1| hypothetical protein AQUCO_01300639v1 [Aquilegia coerulea] Length = 351 Score = 63.5 bits (153), Expect = 8e-09 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +1 Query: 1 HVLEDISHGIESVPSAFAGLFRGDNLGKKIVKVAD 105 H LEDISHGIES+PSAF GLF GDN+GKK+V++AD Sbjct: 316 HALEDISHGIESIPSAFVGLFNGDNIGKKMVQIAD 350 >ref|XP_021817725.1| 2-alkenal reductase (NADP(+)-dependent)-like [Prunus avium] Length = 346 Score = 62.8 bits (151), Expect = 1e-08 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +1 Query: 1 HVLEDISHGIESVPSAFAGLFRGDNLGKKIVKVAD 105 H +EDISHG+ESVPSAF GLFRG N GKKIVK+AD Sbjct: 311 HAIEDISHGLESVPSAFIGLFRGHNTGKKIVKIAD 345 >ref|XP_008242765.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Prunus mume] Length = 346 Score = 62.8 bits (151), Expect = 1e-08 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +1 Query: 1 HVLEDISHGIESVPSAFAGLFRGDNLGKKIVKVAD 105 H +EDISHG+ESVPSAF GLFRG N GKKIVK+AD Sbjct: 311 HAIEDISHGLESVPSAFIGLFRGHNTGKKIVKIAD 345 >ref|XP_010914867.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent) isoform X2 [Elaeis guineensis] Length = 342 Score = 62.4 bits (150), Expect = 2e-08 Identities = 27/33 (81%), Positives = 33/33 (100%) Frame = +1 Query: 7 LEDISHGIESVPSAFAGLFRGDNLGKKIVKVAD 105 LED+SHG+ESVPSAFAGLFRGDN+GKK+V++AD Sbjct: 309 LEDVSHGLESVPSAFAGLFRGDNVGKKLVQLAD 341 >emb|CDP09536.1| unnamed protein product [Coffea canephora] Length = 346 Score = 62.4 bits (150), Expect = 2e-08 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = +1 Query: 4 VLEDISHGIESVPSAFAGLFRGDNLGKKIVKVAD 105 VLEDISHG+ES+PSAF GLFRGDN+GKK+V++AD Sbjct: 312 VLEDISHGLESIPSAFVGLFRGDNIGKKMVQLAD 345 >ref|XP_010914866.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent) isoform X1 [Elaeis guineensis] Length = 347 Score = 62.4 bits (150), Expect = 2e-08 Identities = 27/33 (81%), Positives = 33/33 (100%) Frame = +1 Query: 7 LEDISHGIESVPSAFAGLFRGDNLGKKIVKVAD 105 LED+SHG+ESVPSAFAGLFRGDN+GKK+V++AD Sbjct: 314 LEDVSHGLESVPSAFAGLFRGDNVGKKLVQLAD 346 >gb|KZN00434.1| hypothetical protein DCAR_009188 [Daucus carota subsp. sativus] Length = 348 Score = 62.4 bits (150), Expect = 2e-08 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = +1 Query: 1 HVLEDISHGIESVPSAFAGLFRGDNLGKKIVKVAD 105 H +EDIS G+ES+PSAFAGLFRGDN+GKKIV++AD Sbjct: 313 HSIEDISQGLESIPSAFAGLFRGDNVGKKIVQIAD 347 >ref|XP_017241037.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Daucus carota subsp. sativus] Length = 353 Score = 62.4 bits (150), Expect = 2e-08 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = +1 Query: 1 HVLEDISHGIESVPSAFAGLFRGDNLGKKIVKVAD 105 H +EDIS G+ES+PSAFAGLFRGDN+GKKIV++AD Sbjct: 318 HSIEDISQGLESIPSAFAGLFRGDNVGKKIVQIAD 352 >gb|OIT39357.1| nadp-dependent alkenal double bond reductase p1 [Nicotiana attenuata] Length = 249 Score = 61.6 bits (148), Expect = 2e-08 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = +1 Query: 7 LEDISHGIESVPSAFAGLFRGDNLGKKIVKVAD 105 +ED+SHG+ES+PSAF GLFRGDN+GKKIV+VAD Sbjct: 213 IEDVSHGVESIPSAFIGLFRGDNVGKKIVQVAD 245 >gb|EEF37924.1| alcohol dehydrogenase, putative [Ricinus communis] Length = 50 Score = 57.4 bits (137), Expect = 2e-08 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +1 Query: 4 VLEDISHGIESVPSAFAGLFRGDNLGKKIVKVAD 105 VLEDIS GI S+PSAF GLF+GDN+GKK+VK+AD Sbjct: 15 VLEDISDGILSIPSAFVGLFKGDNVGKKMVKIAD 48 >gb|PHU21411.1| hypothetical protein BC332_06518 [Capsicum chinense] Length = 109 Score = 58.9 bits (141), Expect = 2e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +1 Query: 7 LEDISHGIESVPSAFAGLFRGDNLGKKIVKVAD 105 +EDIS G+ES+PSAF GLF GDN+GKKIVKVAD Sbjct: 76 IEDISQGVESIPSAFIGLFNGDNIGKKIVKVAD 108 >gb|PHT57632.1| hypothetical protein T459_35396 [Capsicum annuum] Length = 109 Score = 58.9 bits (141), Expect = 2e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +1 Query: 7 LEDISHGIESVPSAFAGLFRGDNLGKKIVKVAD 105 +EDIS G+ES+PSAF GLF GDN+GKKIVKVAD Sbjct: 76 IEDISQGVESIPSAFIGLFNGDNIGKKIVKVAD 108 >ref|XP_019189486.1| PREDICTED: NADP-dependent alkenal double bond reductase P2-like [Ipomoea nil] Length = 346 Score = 62.0 bits (149), Expect = 3e-08 Identities = 26/34 (76%), Positives = 33/34 (97%) Frame = +1 Query: 4 VLEDISHGIESVPSAFAGLFRGDNLGKKIVKVAD 105 VLEDISHG+E++PSAF GLFRGDN+GKK+V++AD Sbjct: 312 VLEDISHGVENIPSAFIGLFRGDNIGKKMVQIAD 345 >emb|CBI28191.3| unnamed protein product, partial [Vitis vinifera] Length = 346 Score = 62.0 bits (149), Expect = 3e-08 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +1 Query: 4 VLEDISHGIESVPSAFAGLFRGDNLGKKIVKVAD 105 V+EDIS G+ES+PSAF GLFRGDN+GKKIVK+AD Sbjct: 312 VIEDISQGVESIPSAFVGLFRGDNVGKKIVKIAD 345 >ref|XP_017255913.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Daucus carota subsp. sativus] gb|KZM91714.1| hypothetical protein DCAR_020921 [Daucus carota subsp. sativus] Length = 347 Score = 62.0 bits (149), Expect = 3e-08 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = +1 Query: 1 HVLEDISHGIESVPSAFAGLFRGDNLGKKIVKVAD 105 H LEDIS G+ESVPSAFAG+FRGDN+GKKIV++A+ Sbjct: 312 HALEDISQGLESVPSAFAGIFRGDNVGKKIVQIAE 346