BLASTX nr result
ID: Ophiopogon27_contig00019351
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00019351 (354 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020244122.1| dihydrolipoyl dehydrogenase 2, chloroplastic... 86 4e-17 gb|OWM71133.1| hypothetical protein CDL15_Pgr011260 [Punica gran... 55 4e-06 >ref|XP_020244122.1| dihydrolipoyl dehydrogenase 2, chloroplastic-like [Asparagus officinalis] gb|ONK80027.1| uncharacterized protein A4U43_C01F13000 [Asparagus officinalis] Length = 561 Score = 85.9 bits (211), Expect = 4e-17 Identities = 40/62 (64%), Positives = 50/62 (80%) Frame = -3 Query: 241 SDPAPRSLRFCGFRRETLGFQPLKASSGSIRVRSAQRSIRKPISALSAENGSAASMGSFD 62 S+PAPRSLRFCG RRE LGF PLK+SS ++ VRS R ++ +SALS+ENG+ AS G+FD Sbjct: 22 SEPAPRSLRFCGLRREALGFHPLKSSSSALGVRSRVRLVKTTLSALSSENGAPASKGNFD 81 Query: 61 YD 56 YD Sbjct: 82 YD 83 >gb|OWM71133.1| hypothetical protein CDL15_Pgr011260 [Punica granatum] Length = 636 Score = 54.7 bits (130), Expect = 4e-06 Identities = 34/66 (51%), Positives = 42/66 (63%), Gaps = 4/66 (6%) Frame = -3 Query: 241 SDPAPRSLRFCGFRRETLGFQPLKAS----SGSIRVRSAQRSIRKPISALSAENGSAASM 74 S AP SLRFCG RRE LGF L+ S SGS+ V S R+ + +SA +++NGSA Sbjct: 33 SPAAPASLRFCGLRREALGFSSLRKSGCGASGSVLVASQNRAPGR-VSASASDNGSAPK- 90 Query: 73 GSFDYD 56 SFDYD Sbjct: 91 -SFDYD 95