BLASTX nr result
ID: Ophiopogon27_contig00019339
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00019339 (410 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002302200.1| hypothetical protein POPTR_0002s07410g [Popu... 47 6e-08 ref|XP_020262890.1| ribosome maturation protein SBDS [Asparagus ... 55 6e-06 gb|ONK72547.1| uncharacterized protein A4U43_C04F20560 [Asparagu... 55 6e-06 >ref|XP_002302200.1| hypothetical protein POPTR_0002s07410g [Populus trichocarpa] gb|PNT48327.1| hypothetical protein POPTR_002G073200v3 [Populus trichocarpa] Length = 356 Score = 47.4 bits (111), Expect(2) = 6e-08 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = +2 Query: 2 ALEVIRELQKYFPIKRSPMRLRLTYLRETF 91 AL+VIRELQK+FPIKRSPMRLRL + + F Sbjct: 156 ALDVIRELQKHFPIKRSPMRLRLAVIGQKF 185 Score = 37.0 bits (84), Expect(2) = 6e-08 Identities = 13/26 (50%), Positives = 24/26 (92%) Frame = +1 Query: 94 SLMEKLNSWNASIISEDESANQRSVV 171 +L+EKLN+W+A+++S+DES + +SV+ Sbjct: 187 NLLEKLNAWDANVVSKDESGSHQSVI 212 >ref|XP_020262890.1| ribosome maturation protein SBDS [Asparagus officinalis] Length = 336 Score = 54.7 bits (130), Expect = 6e-06 Identities = 26/49 (53%), Positives = 36/49 (73%) Frame = +1 Query: 28 KVLPHKKITNEITANLPEGNLSSLMEKLNSWNASIISEDESANQRSVVN 174 K P K+ + +P+GNL SL+EKL+SWNASIIS+DES +Q SV++ Sbjct: 140 KHFPIKRSPMRLRLTVPQGNLPSLLEKLSSWNASIISKDESGDQFSVIS 188 >gb|ONK72547.1| uncharacterized protein A4U43_C04F20560 [Asparagus officinalis] Length = 360 Score = 54.7 bits (130), Expect = 6e-06 Identities = 26/49 (53%), Positives = 36/49 (73%) Frame = +1 Query: 28 KVLPHKKITNEITANLPEGNLSSLMEKLNSWNASIISEDESANQRSVVN 174 K P K+ + +P+GNL SL+EKL+SWNASIIS+DES +Q SV++ Sbjct: 164 KHFPIKRSPMRLRLTVPQGNLPSLLEKLSSWNASIISKDESGDQFSVIS 212