BLASTX nr result
ID: Ophiopogon27_contig00019187
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00019187 (395 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020258074.1| uncharacterized protein LOC109834463 isoform... 56 2e-06 >ref|XP_020258074.1| uncharacterized protein LOC109834463 isoform X1 [Asparagus officinalis] gb|ONK76378.1| uncharacterized protein A4U43_C03F27060 [Asparagus officinalis] Length = 415 Score = 55.8 bits (133), Expect = 2e-06 Identities = 49/134 (36%), Positives = 61/134 (45%), Gaps = 16/134 (11%) Frame = +1 Query: 1 MGRRKPKTLRVSAATKXXXXXXXXVNXXXXXXXXXXXXXXXRRIKPDM--NRCSSYVDST 174 MGRRKPKTLR+S + K N + K D N+ S+V + Sbjct: 1 MGRRKPKTLRISGSAKWRSTRGSGDN-KKKSNNSSDERRHPKSEKADFSSNKSISHVGNN 59 Query: 175 VNAGLRGPKRRHEESRATD---LAKNSWMCTERTRNRKKRNSLDQSMSE----------- 312 N+ RG KRR +E + D AKN+ +RTR RKK NSLD S E Sbjct: 60 TNSDSRGTKRRLDERKPIDSSHSAKNT-SIRKRTRRRKKHNSLDLSNHEGSHRDTHLSKV 118 Query: 313 ARIAHVTRSELDDV 354 A AH RSE +DV Sbjct: 119 ANDAHEIRSESNDV 132