BLASTX nr result
ID: Ophiopogon27_contig00018764
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00018764 (370 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020250248.1| uncharacterized protein LOC109827647 [Aspara... 74 6e-13 >ref|XP_020250248.1| uncharacterized protein LOC109827647 [Asparagus officinalis] gb|ONK55226.1| uncharacterized protein A4U43_UnF6170 [Asparagus officinalis] Length = 378 Score = 73.9 bits (180), Expect = 6e-13 Identities = 36/73 (49%), Positives = 50/73 (68%), Gaps = 1/73 (1%) Frame = +3 Query: 36 EGDIPFDQAKKGISASEPATKIGAEAKMKQCKTSKAVWCNLCKLKCNTPAVLDCHLKGKK 215 + D+P + + IS + A K+ E K KQ K + C++C+++CNTPA+LDCHLKGKK Sbjct: 249 DADLPLN-LEDSISDEKAAEKMNTEGKKKQHSRPKVLRCDICRVQCNTPAMLDCHLKGKK 307 Query: 216 HKAQL-SKKGDGV 251 H AQL S+KGD V Sbjct: 308 HMAQLNSRKGDDV 320