BLASTX nr result
ID: Ophiopogon27_contig00018601
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00018601 (432 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020245707.1| AT-hook motif nuclear-localized protein 10-l... 65 2e-09 >ref|XP_020245707.1| AT-hook motif nuclear-localized protein 10-like [Asparagus officinalis] gb|ONK80250.1| uncharacterized protein A4U43_C01F15550 [Asparagus officinalis] Length = 364 Score = 65.1 bits (157), Expect = 2e-09 Identities = 31/51 (60%), Positives = 38/51 (74%) Frame = -1 Query: 153 VGANSYPGSPMMIPNSGGGMSGMRLSFNPMAPSGSKPVDGSTSAYLTDSMP 1 V +SYP S M+IPNSGG M GMR+SF+ M SGSK +DGS+S Y DS+P Sbjct: 19 VSPSSYPNSSMVIPNSGGMMPGMRISFSQMVSSGSKQMDGSSSLYQGDSVP 69