BLASTX nr result
ID: Ophiopogon27_contig00018446
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00018446 (402 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OVA18491.1| SEC7-like [Macleaya cordata] 70 4e-11 ref|XP_008776149.1| PREDICTED: ARF guanine-nucleotide exchange f... 69 9e-11 gb|PON65636.1| Guanine nucleotide exchange factor [Trema orienta... 69 9e-11 gb|PON45836.1| Guanine nucleotide exchange factor, N-terminal [P... 69 9e-11 gb|ONK64793.1| uncharacterized protein A4U43_C07F29980 [Asparagu... 67 2e-10 ref|XP_020092293.1| ARF guanine-nucleotide exchange factor GNOM-... 67 2e-10 gb|OAY85170.1| ARF guanine-nucleotide exchange factor GNOM [Anan... 67 2e-10 ref|XP_009403225.1| PREDICTED: ARF guanine-nucleotide exchange f... 67 2e-10 gb|PKI75498.1| hypothetical protein CRG98_004168 [Punica granatum] 67 4e-10 ref|XP_020276000.1| LOW QUALITY PROTEIN: ARF guanine-nucleotide ... 67 4e-10 gb|OWM89514.1| hypothetical protein CDL15_Pgr024262 [Punica gran... 67 4e-10 ref|XP_006373308.1| Pattern formation protein EMB30 [Populus tri... 67 4e-10 ref|XP_011005073.1| PREDICTED: ARF guanine-nucleotide exchange f... 67 4e-10 ref|XP_021767654.1| ARF guanine-nucleotide exchange factor GNOM-... 66 6e-10 ref|XP_021767652.1| ARF guanine-nucleotide exchange factor GNOM-... 66 6e-10 ref|XP_008371950.1| PREDICTED: ARF guanine-nucleotide exchange f... 66 6e-10 ref|XP_009343100.1| PREDICTED: ARF guanine-nucleotide exchange f... 66 8e-10 ref|XP_022732860.1| LOW QUALITY PROTEIN: ARF guanine-nucleotide ... 66 8e-10 ref|XP_009343823.1| PREDICTED: ARF guanine-nucleotide exchange f... 66 8e-10 gb|ESQ35423.1| hypothetical protein EUTSA_v10009179mg [Eutrema s... 62 9e-10 >gb|OVA18491.1| SEC7-like [Macleaya cordata] Length = 1453 Score = 69.7 bits (169), Expect = 4e-11 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -2 Query: 401 GGDSLWELTWLHVKNIAPSLQAEVFPDQESEQNVSG 294 GGDSLWELTWLHV NIAPSLQ+EVFPDQESEQ G Sbjct: 1402 GGDSLWELTWLHVNNIAPSLQSEVFPDQESEQRQGG 1437 >ref|XP_008776149.1| PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like isoform X1 [Phoenix dactylifera] ref|XP_008776150.1| PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like isoform X3 [Phoenix dactylifera] ref|XP_008776151.1| PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like isoform X2 [Phoenix dactylifera] Length = 1454 Score = 68.6 bits (166), Expect = 9e-11 Identities = 34/48 (70%), Positives = 36/48 (75%), Gaps = 6/48 (12%) Frame = -2 Query: 401 GGDSLWELTWLHVKNIAPSLQAEVFPDQESEQNV------SGIPVQPD 276 GGDSLWELTWLHV NIAPSLQ+EVF QE EQ V SG P+QPD Sbjct: 1390 GGDSLWELTWLHVNNIAPSLQSEVFAGQELEQEVHAKQRESGTPLQPD 1437 >gb|PON65636.1| Guanine nucleotide exchange factor [Trema orientalis] Length = 1466 Score = 68.6 bits (166), Expect = 9e-11 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -2 Query: 401 GGDSLWELTWLHVKNIAPSLQAEVFPDQESEQNVSG 294 GGDSLWELTWLHV NIAPSLQ+EVFPDQ SEQ+ +G Sbjct: 1404 GGDSLWELTWLHVNNIAPSLQSEVFPDQSSEQSPNG 1439 >gb|PON45836.1| Guanine nucleotide exchange factor, N-terminal [Parasponia andersonii] Length = 1466 Score = 68.6 bits (166), Expect = 9e-11 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -2 Query: 401 GGDSLWELTWLHVKNIAPSLQAEVFPDQESEQNVSG 294 GGDSLWELTWLHV NIAPSLQ+EVFPDQ SEQ+ +G Sbjct: 1404 GGDSLWELTWLHVNNIAPSLQSEVFPDQSSEQSPNG 1439 >gb|ONK64793.1| uncharacterized protein A4U43_C07F29980 [Asparagus officinalis] Length = 275 Score = 66.6 bits (161), Expect = 2e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 401 GGDSLWELTWLHVKNIAPSLQAEVFPDQESEQ 306 GGDSLW+LTWLHV NIAPSLQ EVFPDQESEQ Sbjct: 228 GGDSLWDLTWLHVNNIAPSLQTEVFPDQESEQ 259 >ref|XP_020092293.1| ARF guanine-nucleotide exchange factor GNOM-like [Ananas comosus] Length = 1369 Score = 67.4 bits (163), Expect = 2e-10 Identities = 33/49 (67%), Positives = 36/49 (73%), Gaps = 7/49 (14%) Frame = -2 Query: 401 GGDSLWELTWLHVKNIAPSLQAEVFPDQESEQNV-------SGIPVQPD 276 GGDSLWELTWLHV NI+ SLQ+EVFP QESEQ + SG P QPD Sbjct: 1304 GGDSLWELTWLHVNNISTSLQSEVFPGQESEQELHASKQTDSGSPTQPD 1352 >gb|OAY85170.1| ARF guanine-nucleotide exchange factor GNOM [Ananas comosus] Length = 1441 Score = 67.4 bits (163), Expect = 2e-10 Identities = 33/49 (67%), Positives = 36/49 (73%), Gaps = 7/49 (14%) Frame = -2 Query: 401 GGDSLWELTWLHVKNIAPSLQAEVFPDQESEQNV-------SGIPVQPD 276 GGDSLWELTWLHV NI+ SLQ+EVFP QESEQ + SG P QPD Sbjct: 1376 GGDSLWELTWLHVNNISTSLQSEVFPGQESEQELHASKQTDSGSPTQPD 1424 >ref|XP_009403225.1| PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like [Musa acuminata subsp. malaccensis] Length = 1445 Score = 67.4 bits (163), Expect = 2e-10 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = -2 Query: 401 GGDSLWELTWLHVKNIAPSLQAEVFPDQESEQNVSGIPVQPDR 273 GGDSLWELTWLHV NIAPSLQ+EVFP QE EQ SG+ + +R Sbjct: 1393 GGDSLWELTWLHVNNIAPSLQSEVFPGQEMEQLHSGVQPEGNR 1435 >gb|PKI75498.1| hypothetical protein CRG98_004168 [Punica granatum] Length = 1276 Score = 66.6 bits (161), Expect = 4e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 401 GGDSLWELTWLHVKNIAPSLQAEVFPDQESEQ 306 GGDSLWELTWLHV NIAPSLQ+EVFPDQE EQ Sbjct: 1219 GGDSLWELTWLHVNNIAPSLQSEVFPDQEQEQ 1250 >ref|XP_020276000.1| LOW QUALITY PROTEIN: ARF guanine-nucleotide exchange factor GNOM-like [Asparagus officinalis] Length = 1435 Score = 66.6 bits (161), Expect = 4e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 401 GGDSLWELTWLHVKNIAPSLQAEVFPDQESEQ 306 GGDSLW+LTWLHV NIAPSLQ EVFPDQESEQ Sbjct: 1388 GGDSLWDLTWLHVNNIAPSLQTEVFPDQESEQ 1419 >gb|OWM89514.1| hypothetical protein CDL15_Pgr024262 [Punica granatum] Length = 1460 Score = 66.6 bits (161), Expect = 4e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 401 GGDSLWELTWLHVKNIAPSLQAEVFPDQESEQ 306 GGDSLWELTWLHV NIAPSLQ+EVFPDQE EQ Sbjct: 1403 GGDSLWELTWLHVNNIAPSLQSEVFPDQEQEQ 1434 >ref|XP_006373308.1| Pattern formation protein EMB30 [Populus trichocarpa] gb|PNS95798.1| hypothetical protein POPTR_017G078900v3 [Populus trichocarpa] Length = 1470 Score = 66.6 bits (161), Expect = 4e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -2 Query: 401 GGDSLWELTWLHVKNIAPSLQAEVFPDQESEQN 303 GGDSLWELTWLHV NIAPSLQAEVFPDQ+ EQ+ Sbjct: 1404 GGDSLWELTWLHVNNIAPSLQAEVFPDQDREQS 1436 >ref|XP_011005073.1| PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like [Populus euphratica] Length = 1532 Score = 66.6 bits (161), Expect = 4e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -2 Query: 401 GGDSLWELTWLHVKNIAPSLQAEVFPDQESEQN 303 GGDSLWELTWLHV NIAPSLQAEVFPDQ+ EQ+ Sbjct: 1466 GGDSLWELTWLHVNNIAPSLQAEVFPDQDREQS 1498 >ref|XP_021767654.1| ARF guanine-nucleotide exchange factor GNOM-like isoform X2 [Chenopodium quinoa] Length = 1429 Score = 66.2 bits (160), Expect = 6e-10 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -2 Query: 401 GGDSLWELTWLHVKNIAPSLQAEVFPDQESEQNVSGIPVQP 279 GGDSLWELTWLHVKNI+PSLQ+EV+P E + N++ P +P Sbjct: 1384 GGDSLWELTWLHVKNISPSLQSEVYPSAEVDGNINATPFEP 1424 >ref|XP_021767652.1| ARF guanine-nucleotide exchange factor GNOM-like isoform X1 [Chenopodium quinoa] Length = 1443 Score = 66.2 bits (160), Expect = 6e-10 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -2 Query: 401 GGDSLWELTWLHVKNIAPSLQAEVFPDQESEQNVSGIPVQP 279 GGDSLWELTWLHVKNI+PSLQ+EV+P E + N++ P +P Sbjct: 1398 GGDSLWELTWLHVKNISPSLQSEVYPSAEVDGNINATPFEP 1438 >ref|XP_008371950.1| PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like [Malus domestica] Length = 1469 Score = 66.2 bits (160), Expect = 6e-10 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 401 GGDSLWELTWLHVKNIAPSLQAEVFPDQESEQNVS 297 GGDSLWELTWLHV NIAPSLQ+EVFPDQ SEQ+ + Sbjct: 1404 GGDSLWELTWLHVNNIAPSLQSEVFPDQGSEQSAT 1438 >ref|XP_009343100.1| PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like [Pyrus x bretschneideri] Length = 1149 Score = 65.9 bits (159), Expect = 8e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -2 Query: 401 GGDSLWELTWLHVKNIAPSLQAEVFPDQESEQN 303 GGDSLWELTWLHV NIAPSLQ+EVFPDQ SEQ+ Sbjct: 1084 GGDSLWELTWLHVNNIAPSLQSEVFPDQGSEQS 1116 >ref|XP_022732860.1| LOW QUALITY PROTEIN: ARF guanine-nucleotide exchange factor GNOM-like [Durio zibethinus] Length = 1467 Score = 65.9 bits (159), Expect = 8e-10 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -2 Query: 401 GGDSLWELTWLHVKNIAPSLQAEVFPDQESEQNV 300 GGDSLWELTWLHV NIAPSLQ+EVFPDQ+ EQ++ Sbjct: 1403 GGDSLWELTWLHVNNIAPSLQSEVFPDQDPEQSL 1436 >ref|XP_009343823.1| PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like [Pyrus x bretschneideri] ref|XP_009343829.1| PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like [Pyrus x bretschneideri] Length = 1469 Score = 65.9 bits (159), Expect = 8e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -2 Query: 401 GGDSLWELTWLHVKNIAPSLQAEVFPDQESEQN 303 GGDSLWELTWLHV NIAPSLQ+EVFPDQ SEQ+ Sbjct: 1404 GGDSLWELTWLHVNNIAPSLQSEVFPDQGSEQS 1436 >gb|ESQ35423.1| hypothetical protein EUTSA_v10009179mg [Eutrema salsugineum] Length = 99 Score = 61.6 bits (148), Expect = 9e-10 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -2 Query: 401 GGDSLWELTWLHVKNIAPSLQAEVFPDQESEQ 306 GGDSLWELTWLHV NIAPS++ E+FPDQES Q Sbjct: 45 GGDSLWELTWLHVNNIAPSMRLELFPDQESTQ 76