BLASTX nr result
ID: Ophiopogon27_contig00018396
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00018396 (411 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020241750.1| uncharacterized protein LOC109820090 isoform... 62 2e-08 ref|XP_020241749.1| uncharacterized protein LOC109820090 isoform... 62 2e-08 gb|ONK58992.1| uncharacterized protein A4U43_C08F1850 [Asparagus... 62 2e-08 >ref|XP_020241750.1| uncharacterized protein LOC109820090 isoform X2 [Asparagus officinalis] Length = 499 Score = 62.0 bits (149), Expect = 2e-08 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = -1 Query: 411 DFEKILKKAFSEQEENPHTLLHKNLWIEAQVKLFATKY 298 DF+KIL+ FSE+EENP LLHKNLWIEAQVKL KY Sbjct: 449 DFDKILRMNFSEREENPRALLHKNLWIEAQVKLLTMKY 486 >ref|XP_020241749.1| uncharacterized protein LOC109820090 isoform X1 [Asparagus officinalis] Length = 500 Score = 62.0 bits (149), Expect = 2e-08 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = -1 Query: 411 DFEKILKKAFSEQEENPHTLLHKNLWIEAQVKLFATKY 298 DF+KIL+ FSE+EENP LLHKNLWIEAQVKL KY Sbjct: 450 DFDKILRMNFSEREENPRALLHKNLWIEAQVKLLTMKY 487 >gb|ONK58992.1| uncharacterized protein A4U43_C08F1850 [Asparagus officinalis] Length = 1143 Score = 62.0 bits (149), Expect = 2e-08 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = -1 Query: 411 DFEKILKKAFSEQEENPHTLLHKNLWIEAQVKLFATKY 298 DF+KIL+ FSE+EENP LLHKNLWIEAQVKL KY Sbjct: 1093 DFDKILRMNFSEREENPRALLHKNLWIEAQVKLLTMKY 1130