BLASTX nr result
ID: Ophiopogon27_contig00018279
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00018279 (1165 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAP22982.1| Nramp6b [Arabidopsis thaliana] 73 2e-11 ref|XP_020867475.1| metal transporter Nramp6 [Arabidopsis lyrata... 74 6e-11 ref|XP_002887809.1| metal transporter Nramp1 [Arabidopsis lyrata... 74 1e-10 ref|XP_010472867.1| PREDICTED: metal transporter Nramp1 [Camelin... 74 1e-10 ref|XP_010429896.1| PREDICTED: metal transporter Nramp1 [Camelin... 74 1e-10 ref|XP_006301485.1| metal transporter Nramp1 [Capsella rubella] ... 74 1e-10 ref|XP_018444437.1| PREDICTED: metal transporter Nramp1 [Raphanu... 74 1e-10 ref|XP_013652073.1| metal transporter Nramp1-like [Brassica napus] 74 1e-10 ref|XP_009104491.1| PREDICTED: metal transporter Nramp1-like [Br... 74 1e-10 ref|XP_018444315.1| PREDICTED: metal transporter Nramp1-like [Ra... 74 1e-10 ref|XP_010537873.1| PREDICTED: metal transporter Nramp6 [Tarenay... 74 1e-10 ref|XP_013700060.1| metal transporter Nramp1-like [Brassica napus] 73 2e-10 ref|XP_016900340.1| PREDICTED: metal transporter Nramp1-like [Cu... 68 2e-10 ref|XP_018438521.1| PREDICTED: metal transporter Nramp6 isoform ... 73 2e-10 emb|CDY33364.1| BnaC05g12190D [Brassica napus] 73 2e-10 ref|XP_018438513.1| PREDICTED: metal transporter Nramp6 isoform ... 73 3e-10 ref|XP_013586939.1| PREDICTED: LOW QUALITY PROTEIN: metal transp... 73 3e-10 ref|XP_006416859.1| metal transporter Nramp6 [Eutrema salsugineu... 73 3e-10 ref|XP_024018654.1| metal transporter Nramp6 isoform X2 [Morus n... 73 3e-10 gb|EXB50420.1| Metal transporter Nramp6 [Morus notabilis] 73 3e-10 >gb|AAP22982.1| Nramp6b [Arabidopsis thaliana] Length = 180 Score = 72.8 bits (177), Expect = 2e-11 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 2/44 (4%) Frame = +2 Query: 167 IDPEKSWKNFFAYLGPGFLVSIAYIDP--VETDLQSGTQYKYEV 292 + +KSWKNFF+YLGPGFLVSIAYIDP ETDLQSG QYKYE+ Sbjct: 29 VPEKKSWKNFFSYLGPGFLVSIAYIDPGNFETDLQSGAQYKYEL 72 >ref|XP_020867475.1| metal transporter Nramp6 [Arabidopsis lyrata subsp. lyrata] Length = 347 Score = 74.3 bits (181), Expect = 6e-11 Identities = 35/45 (77%), Positives = 39/45 (86%), Gaps = 3/45 (6%) Frame = +2 Query: 167 IDPEKSWKNFFAYLGPGFLVSIAYIDP---VETDLQSGTQYKYEV 292 + +KSWKNFF+YLGPGFLVSIAYIDP VETDLQSG QYKYE+ Sbjct: 29 VPEKKSWKNFFSYLGPGFLVSIAYIDPGNWVETDLQSGAQYKYEL 73 >ref|XP_002887809.1| metal transporter Nramp1 [Arabidopsis lyrata subsp. lyrata] gb|EFH64068.1| NRAMP1 [Arabidopsis lyrata subsp. lyrata] Length = 526 Score = 74.3 bits (181), Expect = 1e-10 Identities = 35/44 (79%), Positives = 38/44 (86%), Gaps = 2/44 (4%) Frame = +2 Query: 167 IDPEKSWKNFFAYLGPGFLVSIAYIDP--VETDLQSGTQYKYEV 292 + +KSWKNFFAYLGPGFLVSIAYIDP ETDLQSG QYKYE+ Sbjct: 31 VSEKKSWKNFFAYLGPGFLVSIAYIDPGNFETDLQSGAQYKYEL 74 >ref|XP_010472867.1| PREDICTED: metal transporter Nramp1 [Camelina sativa] Length = 532 Score = 74.3 bits (181), Expect = 1e-10 Identities = 35/44 (79%), Positives = 38/44 (86%), Gaps = 2/44 (4%) Frame = +2 Query: 167 IDPEKSWKNFFAYLGPGFLVSIAYIDP--VETDLQSGTQYKYEV 292 + +KSWKNFFAYLGPGFLVSIAYIDP ETDLQSG QYKYE+ Sbjct: 37 VSEKKSWKNFFAYLGPGFLVSIAYIDPGNFETDLQSGAQYKYEL 80 >ref|XP_010429896.1| PREDICTED: metal transporter Nramp1 [Camelina sativa] Length = 532 Score = 74.3 bits (181), Expect = 1e-10 Identities = 35/44 (79%), Positives = 38/44 (86%), Gaps = 2/44 (4%) Frame = +2 Query: 167 IDPEKSWKNFFAYLGPGFLVSIAYIDP--VETDLQSGTQYKYEV 292 + +KSWKNFFAYLGPGFLVSIAYIDP ETDLQSG QYKYE+ Sbjct: 37 VSEKKSWKNFFAYLGPGFLVSIAYIDPGNFETDLQSGAQYKYEL 80 >ref|XP_006301485.1| metal transporter Nramp1 [Capsella rubella] gb|EOA34383.1| hypothetical protein CARUB_v10021908mg [Capsella rubella] Length = 533 Score = 74.3 bits (181), Expect = 1e-10 Identities = 35/44 (79%), Positives = 38/44 (86%), Gaps = 2/44 (4%) Frame = +2 Query: 167 IDPEKSWKNFFAYLGPGFLVSIAYIDP--VETDLQSGTQYKYEV 292 + +KSWKNFFAYLGPGFLVSIAYIDP ETDLQSG QYKYE+ Sbjct: 38 VSEKKSWKNFFAYLGPGFLVSIAYIDPGNFETDLQSGAQYKYEL 81 >ref|XP_018444437.1| PREDICTED: metal transporter Nramp1 [Raphanus sativus] Length = 532 Score = 73.9 bits (180), Expect = 1e-10 Identities = 35/44 (79%), Positives = 38/44 (86%), Gaps = 2/44 (4%) Frame = +2 Query: 167 IDPEKSWKNFFAYLGPGFLVSIAYIDP--VETDLQSGTQYKYEV 292 + +KSWKNFFAYLGPGFLVSIAYIDP ETDLQSG QYKYE+ Sbjct: 37 VPEKKSWKNFFAYLGPGFLVSIAYIDPGNFETDLQSGAQYKYEL 80 >ref|XP_013652073.1| metal transporter Nramp1-like [Brassica napus] Length = 532 Score = 73.9 bits (180), Expect = 1e-10 Identities = 35/44 (79%), Positives = 38/44 (86%), Gaps = 2/44 (4%) Frame = +2 Query: 167 IDPEKSWKNFFAYLGPGFLVSIAYIDP--VETDLQSGTQYKYEV 292 + +KSWKNFFAYLGPGFLVSIAYIDP ETDLQSG QYKYE+ Sbjct: 37 VPEKKSWKNFFAYLGPGFLVSIAYIDPGNFETDLQSGAQYKYEL 80 >ref|XP_009104491.1| PREDICTED: metal transporter Nramp1-like [Brassica rapa] Length = 532 Score = 73.9 bits (180), Expect = 1e-10 Identities = 35/44 (79%), Positives = 38/44 (86%), Gaps = 2/44 (4%) Frame = +2 Query: 167 IDPEKSWKNFFAYLGPGFLVSIAYIDP--VETDLQSGTQYKYEV 292 + +KSWKNFFAYLGPGFLVSIAYIDP ETDLQSG QYKYE+ Sbjct: 37 VPEKKSWKNFFAYLGPGFLVSIAYIDPGNFETDLQSGAQYKYEL 80 >ref|XP_018444315.1| PREDICTED: metal transporter Nramp1-like [Raphanus sativus] Length = 533 Score = 73.9 bits (180), Expect = 1e-10 Identities = 35/44 (79%), Positives = 38/44 (86%), Gaps = 2/44 (4%) Frame = +2 Query: 167 IDPEKSWKNFFAYLGPGFLVSIAYIDP--VETDLQSGTQYKYEV 292 + +KSWKNFFAYLGPGFLVSIAYIDP ETDLQSG QYKYE+ Sbjct: 37 VPEKKSWKNFFAYLGPGFLVSIAYIDPGNFETDLQSGAQYKYEL 80 >ref|XP_010537873.1| PREDICTED: metal transporter Nramp6 [Tarenaya hassleriana] Length = 535 Score = 73.9 bits (180), Expect = 1e-10 Identities = 35/44 (79%), Positives = 38/44 (86%), Gaps = 2/44 (4%) Frame = +2 Query: 167 IDPEKSWKNFFAYLGPGFLVSIAYIDP--VETDLQSGTQYKYEV 292 + +KSWKNFFAYLGPGFLVSIAYIDP ETDLQSG QYKYE+ Sbjct: 36 VPEKKSWKNFFAYLGPGFLVSIAYIDPGNFETDLQSGAQYKYEL 79 >ref|XP_013700060.1| metal transporter Nramp1-like [Brassica napus] Length = 335 Score = 72.8 bits (177), Expect = 2e-10 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 2/44 (4%) Frame = +2 Query: 167 IDPEKSWKNFFAYLGPGFLVSIAYIDP--VETDLQSGTQYKYEV 292 + +KSWKNFFAYLGPGFLVSIAYIDP ETDLQ+G QYKYE+ Sbjct: 36 VPEKKSWKNFFAYLGPGFLVSIAYIDPGNFETDLQAGAQYKYEL 79 >ref|XP_016900340.1| PREDICTED: metal transporter Nramp1-like [Cucumis melo] Length = 98 Score = 67.8 bits (164), Expect = 2e-10 Identities = 32/41 (78%), Positives = 36/41 (87%), Gaps = 2/41 (4%) Frame = +2 Query: 176 EKSWKNFFAYLGPGFLVSIAYIDP--VETDLQSGTQYKYEV 292 ++SWKNFFAY+GPGFLVSIAYIDP ET+LQSG QYKY V Sbjct: 41 KESWKNFFAYMGPGFLVSIAYIDPGNFETNLQSGAQYKYGV 81 >ref|XP_018438521.1| PREDICTED: metal transporter Nramp6 isoform X2 [Raphanus sativus] Length = 407 Score = 73.2 bits (178), Expect = 2e-10 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 2/44 (4%) Frame = +2 Query: 167 IDPEKSWKNFFAYLGPGFLVSIAYIDP--VETDLQSGTQYKYEV 292 + +KSWKNFF+YLGPGFLVSIAYIDP ETDLQSG QYKYE+ Sbjct: 29 VSEKKSWKNFFSYLGPGFLVSIAYIDPGNFETDLQSGAQYKYEL 72 >emb|CDY33364.1| BnaC05g12190D [Brassica napus] Length = 492 Score = 73.2 bits (178), Expect = 2e-10 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 2/44 (4%) Frame = +2 Query: 167 IDPEKSWKNFFAYLGPGFLVSIAYIDP--VETDLQSGTQYKYEV 292 + +KSWKNFF+YLGPGFLVSIAYIDP ETDLQSG QYKYE+ Sbjct: 23 VSEKKSWKNFFSYLGPGFLVSIAYIDPGNFETDLQSGAQYKYEL 66 >ref|XP_018438513.1| PREDICTED: metal transporter Nramp6 isoform X1 [Raphanus sativus] Length = 513 Score = 73.2 bits (178), Expect = 3e-10 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 2/44 (4%) Frame = +2 Query: 167 IDPEKSWKNFFAYLGPGFLVSIAYIDP--VETDLQSGTQYKYEV 292 + +KSWKNFF+YLGPGFLVSIAYIDP ETDLQSG QYKYE+ Sbjct: 29 VSEKKSWKNFFSYLGPGFLVSIAYIDPGNFETDLQSGAQYKYEL 72 >ref|XP_013586939.1| PREDICTED: LOW QUALITY PROTEIN: metal transporter Nramp6 [Brassica oleracea var. oleracea] Length = 520 Score = 73.2 bits (178), Expect = 3e-10 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 2/44 (4%) Frame = +2 Query: 167 IDPEKSWKNFFAYLGPGFLVSIAYIDP--VETDLQSGTQYKYEV 292 + +KSWKNFF+YLGPGFLVSIAYIDP ETDLQSG QYKYE+ Sbjct: 23 VSEKKSWKNFFSYLGPGFLVSIAYIDPGNFETDLQSGAQYKYEL 66 >ref|XP_006416859.1| metal transporter Nramp6 [Eutrema salsugineum] gb|ESQ35212.1| hypothetical protein EUTSA_v10009815mg [Eutrema salsugineum] Length = 526 Score = 73.2 bits (178), Expect = 3e-10 Identities = 38/50 (76%), Positives = 41/50 (82%), Gaps = 3/50 (6%) Frame = +2 Query: 152 VSIAYIDPEK-SWKNFFAYLGPGFLVSIAYIDP--VETDLQSGTQYKYEV 292 VS + PEK SWKNFF+YLGPGFLVSIAYIDP ETDLQSG QYKYE+ Sbjct: 23 VSNQIVVPEKKSWKNFFSYLGPGFLVSIAYIDPGNFETDLQSGAQYKYEL 72 >ref|XP_024018654.1| metal transporter Nramp6 isoform X2 [Morus notabilis] Length = 498 Score = 72.8 bits (177), Expect = 3e-10 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 2/44 (4%) Frame = +2 Query: 167 IDPEKSWKNFFAYLGPGFLVSIAYIDP--VETDLQSGTQYKYEV 292 + KSWKNFFAY+GPGFLVSIAYIDP ETDLQSG QYKYE+ Sbjct: 37 VPDRKSWKNFFAYMGPGFLVSIAYIDPGNFETDLQSGAQYKYEL 80 >gb|EXB50420.1| Metal transporter Nramp6 [Morus notabilis] Length = 509 Score = 72.8 bits (177), Expect = 3e-10 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 2/44 (4%) Frame = +2 Query: 167 IDPEKSWKNFFAYLGPGFLVSIAYIDP--VETDLQSGTQYKYEV 292 + KSWKNFFAY+GPGFLVSIAYIDP ETDLQSG QYKYE+ Sbjct: 37 VPDRKSWKNFFAYMGPGFLVSIAYIDPGNFETDLQSGAQYKYEL 80