BLASTX nr result
ID: Ophiopogon27_contig00017978
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00017978 (658 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020262510.1| uncharacterized protein LOC109838480 [Aspara... 56 1e-05 >ref|XP_020262510.1| uncharacterized protein LOC109838480 [Asparagus officinalis] Length = 262 Score = 55.8 bits (133), Expect = 1e-05 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +2 Query: 2 LADILTKAASNKVFSTLCNKLGMIDIYAPA 91 LADILTKA S+KVFST+C+KLGMIDIYAPA Sbjct: 233 LADILTKATSSKVFSTICDKLGMIDIYAPA 262