BLASTX nr result
ID: Ophiopogon27_contig00017961
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00017961 (490 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020261618.1| U11/U12 small nuclear ribonucleoprotein 25 k... 55 3e-06 >ref|XP_020261618.1| U11/U12 small nuclear ribonucleoprotein 25 kDa protein isoform X1 [Asparagus officinalis] ref|XP_020261619.1| U11/U12 small nuclear ribonucleoprotein 25 kDa protein isoform X1 [Asparagus officinalis] ref|XP_020261620.1| U11/U12 small nuclear ribonucleoprotein 25 kDa protein isoform X1 [Asparagus officinalis] ref|XP_020261621.1| U11/U12 small nuclear ribonucleoprotein 25 kDa protein isoform X1 [Asparagus officinalis] ref|XP_020261622.1| U11/U12 small nuclear ribonucleoprotein 25 kDa protein isoform X1 [Asparagus officinalis] gb|ONK72609.1| uncharacterized protein A4U43_C04F21190 [Asparagus officinalis] Length = 172 Score = 55.1 bits (131), Expect = 3e-06 Identities = 29/47 (61%), Positives = 30/47 (63%) Frame = -3 Query: 488 INDDSLLSAYGIHNNSKVHFTPYVMSREFQXXXXXXXXXXXHGLRKR 348 IND +LLS YGI NNSKVHF PYVMSRE Q HGL KR Sbjct: 125 INDSALLSDYGIRNNSKVHFIPYVMSRELQKHSRRKKHRFFHGLSKR 171