BLASTX nr result
ID: Ophiopogon27_contig00017730
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00017730 (455 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020253671.1| cell division control protein 48 homolog D-l... 52 5e-06 >ref|XP_020253671.1| cell division control protein 48 homolog D-like [Asparagus officinalis] Length = 92 Score = 52.4 bits (124), Expect = 5e-06 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = +1 Query: 334 RGQRGILKHVILERKRATNRLVVDEVMNDDNFVMSLNPET 453 +G + ILERK+A NRLVVDE +NDDN V+SLNPET Sbjct: 15 KGAKRDFSTAILERKKAANRLVVDEAVNDDNSVVSLNPET 54