BLASTX nr result
ID: Ophiopogon27_contig00017556
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00017556 (440 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020266613.1| glycosyltransferase-like At2g41451 [Asparagu... 60 2e-07 >ref|XP_020266613.1| glycosyltransferase-like At2g41451 [Asparagus officinalis] Length = 750 Score = 59.7 bits (143), Expect = 2e-07 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = -2 Query: 424 SANTQKIASSKESHATNRKILGFSDIFEKALPPMSPPGLDDHHM 293 SANT++ S SHA NRKIL FSDIFEKA+PP+SPPGLD H+ Sbjct: 709 SANTKE--DSTVSHAINRKILEFSDIFEKAVPPISPPGLDSVHL 750