BLASTX nr result
ID: Ophiopogon27_contig00017553
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00017553 (351 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020247437.1| inactive poly [ADP-ribose] polymerase RCD1 [... 66 3e-10 >ref|XP_020247437.1| inactive poly [ADP-ribose] polymerase RCD1 [Asparagus officinalis] gb|ONK55759.1| uncharacterized protein A4U43_C10F700 [Asparagus officinalis] Length = 636 Score = 66.2 bits (160), Expect = 3e-10 Identities = 34/46 (73%), Positives = 37/46 (80%) Frame = -3 Query: 145 MEARNGKVLVNGGRIVGELKRKRAAPSAAYSGNAMVSQQHNLDLSS 8 MEA N K LVNGGRI GELKRKRAAP AAY+G AMV+QQ N+ SS Sbjct: 1 MEATNVKALVNGGRIAGELKRKRAAPPAAYAGRAMVTQQQNVVPSS 46