BLASTX nr result
ID: Ophiopogon27_contig00017539
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00017539 (553 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_817244.1| ORF45d [Pinus koraiensis] >gi|29469761|gb|AAO74... 60 2e-09 >ref|NP_817244.1| ORF45d [Pinus koraiensis] gb|AAO74089.1| ORF45d (chloroplast) [Pinus koraiensis] Length = 45 Score = 60.5 bits (145), Expect = 2e-09 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -2 Query: 447 LFTCQEPDLNW*HEDFQSSALPTELSRPFPAHH 349 L +CQEPDLNW HEDFQSSALPTELSR FP H Sbjct: 8 LTSCQEPDLNWWHEDFQSSALPTELSRLFPVDH 40