BLASTX nr result
ID: Ophiopogon27_contig00017493
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00017493 (384 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK63522.1| uncharacterized protein A4U43_C07F16090 [Asparagu... 72 2e-12 ref|XP_020271991.1| pentatricopeptide repeat-containing protein ... 72 5e-12 ref|XP_010112924.1| pentatricopeptide repeat-containing protein ... 57 8e-07 >gb|ONK63522.1| uncharacterized protein A4U43_C07F16090 [Asparagus officinalis] Length = 268 Score = 71.6 bits (174), Expect = 2e-12 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = -1 Query: 384 DACFVLEGMEKRKMTLDVEGWDALVEAFCGGCNGSIGLLSEL 259 DACFVLE MEKRKM LD EGW ALV+AFCGGC G+I LL EL Sbjct: 218 DACFVLEEMEKRKMVLDGEGWGALVQAFCGGCKGNIDLLREL 259 >ref|XP_020271991.1| pentatricopeptide repeat-containing protein At1g07740, mitochondrial-like [Asparagus officinalis] Length = 383 Score = 71.6 bits (174), Expect = 5e-12 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = -1 Query: 384 DACFVLEGMEKRKMTLDVEGWDALVEAFCGGCNGSIGLLSEL 259 DACFVLE MEKRKM LD EGW ALV+AFCGGC G+I LL EL Sbjct: 331 DACFVLEEMEKRKMVLDGEGWGALVQAFCGGCKGNIDLLREL 372 >ref|XP_010112924.1| pentatricopeptide repeat-containing protein At1g07740, mitochondrial [Morus notabilis] gb|EXC35073.1| hypothetical protein L484_010855 [Morus notabilis] Length = 461 Score = 57.0 bits (136), Expect = 8e-07 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = -1 Query: 384 DACFVLEGMEKRKMTLDVEGWDALVEAFCGGCNGSIGLLSEL 259 DACFVLE M KRKM D+EGWDALV CG +G+ GL++EL Sbjct: 416 DACFVLEEMGKRKMQFDLEGWDALVVEACGRNSGADGLVTEL 457