BLASTX nr result
ID: Ophiopogon27_contig00017376
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00017376 (619 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020252166.1| protein indeterminate-domain 16 [Asparagus o... 79 3e-15 ref|XP_008805299.1| PREDICTED: protein SHOOT GRAVITROPISM 5 [Pho... 68 8e-11 ref|XP_010917524.1| PREDICTED: protein indeterminate-domain 16 [... 67 2e-10 ref|XP_010905176.1| PREDICTED: protein indeterminate-domain 16-l... 64 2e-09 ref|XP_020684828.1| protein SHOOT GRAVITROPISM 5-like [Dendrobiu... 57 1e-06 ref|XP_020683585.1| protein SHOOT GRAVITROPISM 5-like [Dendrobiu... 56 2e-06 gb|KQL29750.1| hypothetical protein SETIT_018469mg [Setaria ital... 55 9e-06 ref|XP_018686794.1| PREDICTED: protein indeterminate-domain 16-l... 54 1e-05 >ref|XP_020252166.1| protein indeterminate-domain 16 [Asparagus officinalis] gb|ONK77794.1| uncharacterized protein A4U43_C02F10730 [Asparagus officinalis] Length = 124 Score = 78.6 bits (192), Expect = 3e-15 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = +1 Query: 409 ELDLSLSMSVGQSQPSPSSDEAESNMRSIRALKRHNAEQIRFAAVEKAYA 558 ELDLSLS+SVGQSQ SP ++EAESNMRS+ LKR NAEQIR AAVEKAYA Sbjct: 9 ELDLSLSISVGQSQSSPKTEEAESNMRSMEVLKRQNAEQIRLAAVEKAYA 58 >ref|XP_008805299.1| PREDICTED: protein SHOOT GRAVITROPISM 5 [Phoenix dactylifera] Length = 168 Score = 68.2 bits (165), Expect = 8e-11 Identities = 36/54 (66%), Positives = 45/54 (83%) Frame = +1 Query: 397 ATPPELDLSLSMSVGQSQPSPSSDEAESNMRSIRALKRHNAEQIRFAAVEKAYA 558 A P LDLSLSMSVG +P PS+++A+SNMR+++ALK+ AEQIR AAVEKAYA Sbjct: 52 ADHPSLDLSLSMSVGPWRP-PSNEDAKSNMRNVQALKQQTAEQIRLAAVEKAYA 104 >ref|XP_010917524.1| PREDICTED: protein indeterminate-domain 16 [Elaeis guineensis] Length = 172 Score = 67.4 bits (163), Expect = 2e-10 Identities = 37/54 (68%), Positives = 44/54 (81%) Frame = +1 Query: 397 ATPPELDLSLSMSVGQSQPSPSSDEAESNMRSIRALKRHNAEQIRFAAVEKAYA 558 A P LDLSLSMSVG +P PS++EA+SNMR+ +ALK+ AEQIR AAVEKAYA Sbjct: 56 ADHPPLDLSLSMSVGPWRP-PSNEEAKSNMRNAQALKQQTAEQIRLAAVEKAYA 108 >ref|XP_010905176.1| PREDICTED: protein indeterminate-domain 16-like [Elaeis guineensis] Length = 151 Score = 64.3 bits (155), Expect = 2e-09 Identities = 35/60 (58%), Positives = 46/60 (76%), Gaps = 3/60 (5%) Frame = +1 Query: 388 PSAATP---PELDLSLSMSVGQSQPSPSSDEAESNMRSIRALKRHNAEQIRFAAVEKAYA 558 P++ P P LDL+LSM VG +P PS++EA SNMR+ +ALK+ +AEQIR AAV+KAYA Sbjct: 29 PASTNPSDQPPLDLNLSMCVGPRRP-PSNEEARSNMRNAQALKQQSAEQIRLAAVDKAYA 87 >ref|XP_020684828.1| protein SHOOT GRAVITROPISM 5-like [Dendrobium catenatum] gb|PKU74534.1| hypothetical protein MA16_Dca003737 [Dendrobium catenatum] Length = 163 Score = 57.0 bits (136), Expect = 1e-06 Identities = 30/60 (50%), Positives = 41/60 (68%) Frame = +1 Query: 379 TFRPSAATPPELDLSLSMSVGQSQPSPSSDEAESNMRSIRALKRHNAEQIRFAAVEKAYA 558 T S +T P LDLSLSMSV +P + EA S++RS++ LK+ AEQ+R A +E+AYA Sbjct: 40 TMERSNSTEPTLDLSLSMSVAPPWMTPGNLEAGSSLRSLQVLKQQVAEQVRLATLERAYA 99 >ref|XP_020683585.1| protein SHOOT GRAVITROPISM 5-like [Dendrobium catenatum] Length = 152 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/51 (52%), Positives = 42/51 (82%) Frame = +1 Query: 406 PELDLSLSMSVGQSQPSPSSDEAESNMRSIRALKRHNAEQIRFAAVEKAYA 558 P+LDL+LSMS+ Q S +S+EA+SN+++++ LK+H AEQ+R AA+E+ YA Sbjct: 39 PQLDLNLSMSIITPQMS-ASNEADSNLQNVQVLKQHAAEQVRLAALERVYA 88 >gb|KQL29750.1| hypothetical protein SETIT_018469mg [Setaria italica] Length = 177 Score = 54.7 bits (130), Expect = 9e-06 Identities = 31/72 (43%), Positives = 43/72 (59%), Gaps = 14/72 (19%) Frame = +1 Query: 385 RPSAATP--PELDLSLSMSVGQSQPSP------------SSDEAESNMRSIRALKRHNAE 522 RP A T P+LDLSLS+S+G P+P S+D+++ ++ALKRH AE Sbjct: 38 RPPATTSDHPQLDLSLSISIGPPPPAPQPSPPPAPPPAASADQSKKAAADVQALKRHTAE 97 Query: 523 QIRFAAVEKAYA 558 Q R A+ E+AYA Sbjct: 98 QARMASAERAYA 109 >ref|XP_018686794.1| PREDICTED: protein indeterminate-domain 16-like [Musa acuminata subsp. malaccensis] Length = 162 Score = 54.3 bits (129), Expect = 1e-05 Identities = 28/55 (50%), Positives = 39/55 (70%) Frame = +1 Query: 394 AATPPELDLSLSMSVGQSQPSPSSDEAESNMRSIRALKRHNAEQIRFAAVEKAYA 558 A+ P LDL+LSM VG +PSP +E++S +S++ L++ AEQIR AA E AYA Sbjct: 45 ASDHPLLDLTLSMRVGTQRPSPG-EESQSRAKSLQVLRQQTAEQIRLAAAENAYA 98