BLASTX nr result
ID: Ophiopogon27_contig00017247
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00017247 (424 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020250108.1| putative methylesterase 14, chloroplastic is... 60 9e-08 >ref|XP_020250108.1| putative methylesterase 14, chloroplastic isoform X1 [Asparagus officinalis] ref|XP_020250109.1| putative methylesterase 14, chloroplastic isoform X2 [Asparagus officinalis] gb|ONK55323.1| uncharacterized protein A4U43_UnF5020 [Asparagus officinalis] Length = 399 Score = 60.1 bits (144), Expect = 9e-08 Identities = 29/47 (61%), Positives = 37/47 (78%), Gaps = 2/47 (4%) Frame = -1 Query: 424 REVHKIKASDHCPFFSKPQALNRILLEIAGSATS--LDNERTDKHEE 290 R V+KIK SDHCPFFSKPQ+LN+ILLEIAG T+ +NE D+ ++ Sbjct: 352 RGVYKIKGSDHCPFFSKPQSLNKILLEIAGFNTAGLAENEMIDREKD 398