BLASTX nr result
ID: Ophiopogon27_contig00017071
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00017071 (386 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK59479.1| uncharacterized protein A4U43_C08F6850 [Asparagus... 64 2e-09 ref|XP_009395916.1| PREDICTED: glutamic acid-rich protein [Musa ... 59 1e-07 >gb|ONK59479.1| uncharacterized protein A4U43_C08F6850 [Asparagus officinalis] Length = 348 Score = 64.3 bits (155), Expect = 2e-09 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = +1 Query: 265 EDVILPSLPNIDNMTNEEKLLIRSKYKLEHFWLGSCYHLE 384 EDV LPSLP++ M+ EEKLLI SKY+LE FW+ SCYHLE Sbjct: 194 EDVTLPSLPDVGTMSKEEKLLIASKYRLEQFWVTSCYHLE 233 >ref|XP_009395916.1| PREDICTED: glutamic acid-rich protein [Musa acuminata subsp. malaccensis] ref|XP_018680444.1| PREDICTED: glutamic acid-rich protein [Musa acuminata subsp. malaccensis] Length = 216 Score = 58.5 bits (140), Expect = 1e-07 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = +1 Query: 265 EDVILPSLPNIDNMTNEEKLLIRSKYKLEHFWLGSCYHLE 384 EDV LPS+P++D ++NE K LI SK KLE+FW GSCY+L+ Sbjct: 36 EDVTLPSVPSVDPLSNEVKALIASKIKLEYFWKGSCYNLQ 75