BLASTX nr result
ID: Ophiopogon27_contig00017006
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00017006 (395 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK65228.1| uncharacterized protein A4U43_C07F34990 [Asparagu... 54 5e-06 >gb|ONK65228.1| uncharacterized protein A4U43_C07F34990 [Asparagus officinalis] Length = 201 Score = 53.9 bits (128), Expect = 5e-06 Identities = 26/49 (53%), Positives = 33/49 (67%) Frame = +3 Query: 9 WHQRSPNCPNDVGEPSIKNQPARSSYDGEEEEEGMILPDEEEGIIHPDE 155 WHQ+ N EP +P RS+ G+E EEGMI+P+EEEG+IHPDE Sbjct: 156 WHQKFQNPRPSNDEPV---RPQRSATGGDEAEEGMIMPEEEEGMIHPDE 201