BLASTX nr result
ID: Ophiopogon27_contig00016896
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00016896 (447 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020265716.1| two-component response regulator ORR22-like ... 65 2e-09 >ref|XP_020265716.1| two-component response regulator ORR22-like [Asparagus officinalis] gb|ONK70425.1| uncharacterized protein A4U43_C05F33600 [Asparagus officinalis] Length = 651 Score = 65.5 bits (158), Expect = 2e-09 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +3 Query: 3 VGNPMIKPECDDFIFIDGDMGCNDLYSLGACM 98 V N MIKPECDDF FIDGD+GCNDLYSLGACM Sbjct: 620 VTNAMIKPECDDFTFIDGDIGCNDLYSLGACM 651