BLASTX nr result
ID: Ophiopogon27_contig00016755
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00016755 (872 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK74708.1| uncharacterized protein A4U43_C03F9320 [Asparagus... 60 1e-07 gb|PNX72687.1| glycerol-3-phosphate acyltransferase 3-like prote... 55 1e-06 ref|XP_020256489.1| glycerol-3-phosphate acyltransferase 3-like ... 60 2e-06 ref|XP_020256490.1| glycerol-3-phosphate acyltransferase 3-like ... 60 2e-06 gb|KNA03447.1| hypothetical protein SOVF_209110 [Spinacia oleracea] 55 2e-06 gb|PKU78677.1| Lysophospholipid acyltransferase LPEAT1 [Dendrobi... 59 3e-06 gb|PKI33120.1| hypothetical protein CRG98_046495 [Punica granatum] 57 4e-06 gb|PKA60207.1| Lysophospholipid acyltransferase LPEAT1 [Apostasi... 59 4e-06 gb|PNX89137.1| glycerol-3-phosphate acyltransferase 3-like prote... 55 4e-06 ref|XP_020699520.1| glycerol-3-phosphate acyltransferase 3-like ... 59 5e-06 ref|XP_020587761.1| glycerol-3-phosphate acyltransferase 3 [Phal... 59 5e-06 ref|XP_020095637.1| glycerol-3-phosphate acyltransferase 3-like ... 59 5e-06 gb|OAE20071.1| hypothetical protein AXG93_2584s1550 [Marchantia ... 58 5e-06 gb|ABR26156.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase ze... 55 6e-06 ref|XP_009401662.1| PREDICTED: glycerol-3-phosphate acyltransfer... 58 6e-06 ref|XP_010911995.2| PREDICTED: LOW QUALITY PROTEIN: glycerol-3-p... 58 8e-06 gb|ANW48416.1| GPAT9 [Cocos nucifera] 58 8e-06 ref|XP_009384450.1| PREDICTED: glycerol-3-phosphate acyltransfer... 58 8e-06 ref|XP_008785836.1| PREDICTED: glycerol-3-phosphate acyltransfer... 58 8e-06 >gb|ONK74708.1| uncharacterized protein A4U43_C03F9320 [Asparagus officinalis] Length = 121 Score = 59.7 bits (143), Expect = 1e-07 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -3 Query: 870 MASWAVICDVWYLEPQFLRLGEPPIEFTER 781 M SWAV+CDVWYLEPQFLR GE PIEF ER Sbjct: 44 MTSWAVVCDVWYLEPQFLRPGETPIEFAER 73 >gb|PNX72687.1| glycerol-3-phosphate acyltransferase 3-like protein [Trifolium pratense] Length = 63 Score = 55.1 bits (131), Expect = 1e-06 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = -3 Query: 870 MASWAVICDVWYLEPQFLRLGEPPIEFTER 781 M SWAV+CDVWYLEPQ L+ GE PIEF ER Sbjct: 1 MTSWAVVCDVWYLEPQNLKPGETPIEFAER 30 >ref|XP_020256489.1| glycerol-3-phosphate acyltransferase 3-like isoform X1 [Asparagus officinalis] Length = 374 Score = 59.7 bits (143), Expect = 2e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -3 Query: 870 MASWAVICDVWYLEPQFLRLGEPPIEFTER 781 M SWAV+CDVWYLEPQFLR GE PIEF ER Sbjct: 297 MTSWAVVCDVWYLEPQFLRPGETPIEFAER 326 >ref|XP_020256490.1| glycerol-3-phosphate acyltransferase 3-like isoform X2 [Asparagus officinalis] Length = 377 Score = 59.7 bits (143), Expect = 2e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -3 Query: 870 MASWAVICDVWYLEPQFLRLGEPPIEFTER 781 M SWAV+CDVWYLEPQFLR GE PIEF ER Sbjct: 300 MTSWAVVCDVWYLEPQFLRPGETPIEFAER 329 >gb|KNA03447.1| hypothetical protein SOVF_209110 [Spinacia oleracea] Length = 78 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/37 (62%), Positives = 28/37 (75%) Frame = -3 Query: 870 MASWAVICDVWYLEPQFLRLGEPPIEFTER*NILFSY 760 M SWAV+CDVWYLEPQ ++ GE PIEF ER + S+ Sbjct: 1 MTSWAVVCDVWYLEPQTIKPGETPIEFAERVRDIISH 37 >gb|PKU78677.1| Lysophospholipid acyltransferase LPEAT1 [Dendrobium catenatum] Length = 293 Score = 58.5 bits (140), Expect = 3e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -3 Query: 870 MASWAVICDVWYLEPQFLRLGEPPIEFTER 781 M SWAV+CDVWYLEPQ+LR GE PIEF ER Sbjct: 210 MTSWAVVCDVWYLEPQYLRPGETPIEFAER 239 >gb|PKI33120.1| hypothetical protein CRG98_046495 [Punica granatum] Length = 203 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = -3 Query: 870 MASWAVICDVWYLEPQFLRLGEPPIEFTER 781 M SWAV+CDVWYLEPQ LR GE PIEF ER Sbjct: 126 MTSWAVVCDVWYLEPQLLRPGETPIEFAER 155 >gb|PKA60207.1| Lysophospholipid acyltransferase LPEAT1 [Apostasia shenzhenica] Length = 412 Score = 58.9 bits (141), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -3 Query: 870 MASWAVICDVWYLEPQFLRLGEPPIEFTER 781 M SWAV+CDVWYLEPQ+LR GE PIEF ER Sbjct: 336 MTSWAVVCDVWYLEPQYLRRGETPIEFAER 365 >gb|PNX89137.1| glycerol-3-phosphate acyltransferase 3-like protein, partial [Trifolium pratense] Length = 105 Score = 55.1 bits (131), Expect = 4e-06 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = -3 Query: 870 MASWAVICDVWYLEPQFLRLGEPPIEFTER 781 M SWAV+CDVWYLEPQ L+ GE PIEF ER Sbjct: 44 MTSWAVVCDVWYLEPQNLKPGETPIEFAER 73 >ref|XP_020699520.1| glycerol-3-phosphate acyltransferase 3-like [Dendrobium catenatum] Length = 370 Score = 58.5 bits (140), Expect = 5e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -3 Query: 870 MASWAVICDVWYLEPQFLRLGEPPIEFTER 781 M SWAV+CDVWYLEPQ+LR GE PIEF ER Sbjct: 294 MTSWAVVCDVWYLEPQYLRPGETPIEFAER 323 >ref|XP_020587761.1| glycerol-3-phosphate acyltransferase 3 [Phalaenopsis equestris] Length = 370 Score = 58.5 bits (140), Expect = 5e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -3 Query: 870 MASWAVICDVWYLEPQFLRLGEPPIEFTER 781 M SWAV+CDVWYLEPQ+LR GE PIEF ER Sbjct: 294 MTSWAVVCDVWYLEPQYLRPGETPIEFAER 323 >ref|XP_020095637.1| glycerol-3-phosphate acyltransferase 3-like [Ananas comosus] gb|OAY67289.1| Glycerol-3-phosphate acyltransferase 3 [Ananas comosus] Length = 372 Score = 58.5 bits (140), Expect = 5e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -3 Query: 870 MASWAVICDVWYLEPQFLRLGEPPIEFTER 781 M SWAV+CDVWYLEPQ+LR GE PIEF ER Sbjct: 295 MTSWAVVCDVWYLEPQYLRPGETPIEFAER 324 >gb|OAE20071.1| hypothetical protein AXG93_2584s1550 [Marchantia polymorpha subsp. ruderalis] Length = 323 Score = 58.2 bits (139), Expect = 5e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -3 Query: 870 MASWAVICDVWYLEPQFLRLGEPPIEFTER 781 M SWAV+CDVWYLEPQ L+LGE PIEF ER Sbjct: 242 MTSWAVVCDVWYLEPQTLKLGETPIEFAER 271 >gb|ABR26156.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase zeta precursor, partial [Oryza sativa Indica Group] Length = 120 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = -3 Query: 870 MASWAVICDVWYLEPQFLRLGEPPIEFTER 781 M SWAV+CDVWYLEPQ+LR GE IEF ER Sbjct: 43 MTSWAVVCDVWYLEPQYLRDGETAIEFAER 72 >ref|XP_009401662.1| PREDICTED: glycerol-3-phosphate acyltransferase 3 [Musa acuminata subsp. malaccensis] Length = 371 Score = 58.2 bits (139), Expect = 6e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -3 Query: 870 MASWAVICDVWYLEPQFLRLGEPPIEFTER 781 M SWAV+CDVWYLEPQ++R GE PIEF ER Sbjct: 294 MTSWAVVCDVWYLEPQYIRSGETPIEFAER 323 >ref|XP_010911995.2| PREDICTED: LOW QUALITY PROTEIN: glycerol-3-phosphate acyltransferase 3 [Elaeis guineensis] Length = 371 Score = 57.8 bits (138), Expect = 8e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -3 Query: 870 MASWAVICDVWYLEPQFLRLGEPPIEFTER 781 M SWAV+CDVWYLEPQ++R GE PIEF ER Sbjct: 294 MTSWAVVCDVWYLEPQYIRPGETPIEFAER 323 >gb|ANW48416.1| GPAT9 [Cocos nucifera] Length = 371 Score = 57.8 bits (138), Expect = 8e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -3 Query: 870 MASWAVICDVWYLEPQFLRLGEPPIEFTER 781 M SWAV+CDVWYLEPQ++R GE PIEF ER Sbjct: 294 MTSWAVVCDVWYLEPQYIRPGETPIEFAER 323 >ref|XP_009384450.1| PREDICTED: glycerol-3-phosphate acyltransferase 3-like [Musa acuminata subsp. malaccensis] Length = 371 Score = 57.8 bits (138), Expect = 8e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -3 Query: 870 MASWAVICDVWYLEPQFLRLGEPPIEFTER 781 M SWAV+CDVWYLEPQ++R GE PIEF ER Sbjct: 294 MTSWAVVCDVWYLEPQYIRPGETPIEFAER 323 >ref|XP_008785836.1| PREDICTED: glycerol-3-phosphate acyltransferase 3 [Phoenix dactylifera] Length = 371 Score = 57.8 bits (138), Expect = 8e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -3 Query: 870 MASWAVICDVWYLEPQFLRLGEPPIEFTER 781 M SWAV+CDVWYLEPQ++R GE PIEF ER Sbjct: 294 MTSWAVVCDVWYLEPQYIRPGETPIEFAER 323