BLASTX nr result
ID: Ophiopogon27_contig00016752
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00016752 (360 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACG31025.1| hypothetical protein [Zea mays] 67 2e-12 gb|EMS53177.1| Histone H2B.2 [Triticum urartu] 67 2e-12 gb|EMS46916.1| Histone H2B.2 [Triticum urartu] 67 2e-12 gb|ACR37464.1| unknown [Zea mays] 67 2e-12 gb|AAK48889.1|AF356817_1 histone H2B-1, partial [Lolium perenne] 67 2e-12 gb|OSN12131.1| hypothetical protein BV341_05768 [Pseudomonas syr... 67 3e-12 gb|EMS67716.1| Histone H2B.2 [Triticum urartu] 67 3e-12 dbj|BAF03961.1| Os01g0152700, partial [Oryza sativa Japonica Gro... 66 3e-12 gb|AAC05126.1| histone H2B, partial [Malus domestica] 67 4e-12 gb|PNX58921.1| putative histone H2B-like protein, partial [Trifo... 66 4e-12 gb|EEE63986.1| hypothetical protein OsJ_18815 [Oryza sativa Japo... 67 4e-12 gb|EEC79354.1| hypothetical protein OsI_20231 [Oryza sativa Indi... 67 4e-12 gb|KYP51809.1| Histone H2B, partial [Cajanus cajan] 66 5e-12 ref|XP_020268042.1| histone H2B.3 [Asparagus officinalis] 67 5e-12 dbj|BAS94402.1| Os05g0460475, partial [Oryza sativa Japonica Group] 67 6e-12 gb|PHT61333.1| Histone H2B [Capsicum annuum] 66 6e-12 gb|AQL07611.1| Histone H2B [Zea mays] >gi|1142849526|gb|AQL07612... 66 6e-12 ref|XP_023921557.1| histone H2B.9 [Quercus suber] >gi|223527090|... 66 6e-12 gb|EMS61387.1| Histone H2B.8 [Triticum urartu] 66 6e-12 gb|EFH49239.1| hypothetical protein ARALYDRAFT_912258 [Arabidops... 66 6e-12 >gb|ACG31025.1| hypothetical protein [Zea mays] Length = 66 Score = 67.0 bits (162), Expect = 2e-12 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 358 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 257 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 33 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 66 >gb|EMS53177.1| Histone H2B.2 [Triticum urartu] Length = 66 Score = 67.0 bits (162), Expect = 2e-12 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 358 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 257 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 33 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 66 >gb|EMS46916.1| Histone H2B.2 [Triticum urartu] Length = 66 Score = 67.0 bits (162), Expect = 2e-12 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 358 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 257 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 33 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 66 >gb|ACR37464.1| unknown [Zea mays] Length = 66 Score = 67.0 bits (162), Expect = 2e-12 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 358 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 257 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 33 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 66 >gb|AAK48889.1|AF356817_1 histone H2B-1, partial [Lolium perenne] Length = 70 Score = 67.0 bits (162), Expect = 2e-12 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 358 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 257 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 37 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 70 >gb|OSN12131.1| hypothetical protein BV341_05768 [Pseudomonas syringae pv. actinidiae] Length = 66 Score = 66.6 bits (161), Expect = 3e-12 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 358 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 257 SREIQTSVRL+LPGELAKHAVSEGTKAVTKFTSS Sbjct: 33 SREIQTSVRLILPGELAKHAVSEGTKAVTKFTSS 66 >gb|EMS67716.1| Histone H2B.2 [Triticum urartu] Length = 83 Score = 67.0 bits (162), Expect = 3e-12 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 358 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 257 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 50 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 83 >dbj|BAF03961.1| Os01g0152700, partial [Oryza sativa Japonica Group] dbj|BAS70442.1| Os01g0152700, partial [Oryza sativa Japonica Group] Length = 41 Score = 65.9 bits (159), Expect = 3e-12 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 358 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 257 SREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 8 SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 41 >gb|AAC05126.1| histone H2B, partial [Malus domestica] Length = 93 Score = 67.0 bits (162), Expect = 4e-12 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 358 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 257 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 60 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 93 >gb|PNX58921.1| putative histone H2B-like protein, partial [Trifolium pratense] gb|PNX98096.1| putative histone H2B-like protein, partial [Trifolium pratense] Length = 52 Score = 65.9 bits (159), Expect = 4e-12 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 358 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 257 SREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 19 SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 52 >gb|EEE63986.1| hypothetical protein OsJ_18815 [Oryza sativa Japonica Group] Length = 95 Score = 67.0 bits (162), Expect = 4e-12 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 358 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 257 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 62 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 95 >gb|EEC79354.1| hypothetical protein OsI_20231 [Oryza sativa Indica Group] Length = 95 Score = 67.0 bits (162), Expect = 4e-12 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 358 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 257 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 62 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 95 >gb|KYP51809.1| Histone H2B, partial [Cajanus cajan] Length = 59 Score = 65.9 bits (159), Expect = 5e-12 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 358 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 257 SREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 26 SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 59 >ref|XP_020268042.1| histone H2B.3 [Asparagus officinalis] Length = 101 Score = 67.0 bits (162), Expect = 5e-12 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 358 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 257 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 68 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 101 >dbj|BAS94402.1| Os05g0460475, partial [Oryza sativa Japonica Group] Length = 106 Score = 67.0 bits (162), Expect = 6e-12 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 358 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 257 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 73 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 106 >gb|PHT61333.1| Histone H2B [Capsicum annuum] Length = 66 Score = 65.9 bits (159), Expect = 6e-12 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 358 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 257 SREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 33 SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 66 >gb|AQL07611.1| Histone H2B [Zea mays] gb|AQL07612.1| Histone H2B [Zea mays] gb|AQL07613.1| Histone H2B [Zea mays] Length = 66 Score = 65.9 bits (159), Expect = 6e-12 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 358 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 257 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTS+ Sbjct: 33 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSN 66 >ref|XP_023921557.1| histone H2B.9 [Quercus suber] gb|EEF29271.1| histone h2b, putative [Ricinus communis] gb|AFK37118.1| unknown [Medicago truncatula] gb|KYP60672.1| putative histone H2B.3 [Cajanus cajan] gb|PNX80296.1| putative histone H2B-like protein [Trifolium pratense] gb|PNX86097.1| putative histone H2B-like protein [Trifolium pratense] gb|PPS05294.1| hypothetical protein GOBAR_AA15358 [Gossypium barbadense] gb|PPS05295.1| hypothetical protein GOBAR_AA15359 [Gossypium barbadense] Length = 66 Score = 65.9 bits (159), Expect = 6e-12 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 358 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 257 SREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 33 SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 66 >gb|EMS61387.1| Histone H2B.8 [Triticum urartu] Length = 66 Score = 65.9 bits (159), Expect = 6e-12 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 358 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 257 SREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 33 SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 66 >gb|EFH49239.1| hypothetical protein ARALYDRAFT_912258 [Arabidopsis lyrata subsp. lyrata] Length = 66 Score = 65.9 bits (159), Expect = 6e-12 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 358 SREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS 257 SREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS Sbjct: 33 SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 66