BLASTX nr result
ID: Ophiopogon27_contig00016737
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00016737 (669 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020267004.1| reticulon-like protein B11 [Asparagus offici... 50 2e-07 >ref|XP_020267004.1| reticulon-like protein B11 [Asparagus officinalis] Length = 185 Score = 50.1 bits (118), Expect(2) = 2e-07 Identities = 28/39 (71%), Positives = 30/39 (76%) Frame = +3 Query: 210 LVSIIFFRAKSAILFNRHVTLNPNLEISNVVMEKATETV 326 LVSIIFF AKSA L NR + PNLEISN V+EKATE V Sbjct: 49 LVSIIFFWAKSATLLNRPLPPIPNLEISNEVVEKATERV 87 Score = 33.1 bits (74), Expect(2) = 2e-07 Identities = 16/25 (64%), Positives = 19/25 (76%) Frame = +1 Query: 328 VWINHVLVMAIGMCIG*DRKVFLQV 402 VWIN VL +A + +G DRKVFLQV Sbjct: 89 VWINRVLSVARDIGVGRDRKVFLQV 113