BLASTX nr result
ID: Ophiopogon27_contig00016585
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00016585 (909 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020265558.1| protein RER1A-like [Asparagus officinalis] >... 90 1e-17 ref|XP_003524658.1| PREDICTED: protein RER1A-like [Glycine max] ... 88 3e-17 ref|XP_009396419.1| PREDICTED: protein RER1A-like [Musa acuminat... 88 5e-17 ref|XP_009395853.1| PREDICTED: protein RER1A-like [Musa acuminat... 87 6e-17 gb|KMZ72724.1| putative Rer1 protein [Zostera marina] 87 8e-17 gb|KHN27074.1| Protein RER1A, partial [Glycine soja] 86 1e-16 ref|XP_009619624.1| PREDICTED: protein RER1A-like [Nicotiana tom... 87 1e-16 ref|XP_008799708.1| PREDICTED: protein RER1A-like [Phoenix dacty... 87 1e-16 dbj|GAU26059.1| hypothetical protein TSUD_225210 [Trifolium subt... 87 1e-16 gb|KHN42107.1| Protein RER1A [Glycine soja] 86 1e-16 gb|KHN36256.1| Protein RER1A [Glycine soja] 86 1e-16 gb|PIN03800.1| Golgi proteins involved in ER retention (RER) [Ha... 86 2e-16 ref|XP_003550042.1| PREDICTED: protein RER1A-like [Glycine max] ... 86 2e-16 ref|XP_021897631.1| protein RER1A-like [Carica papaya] 86 2e-16 ref|XP_010270832.1| PREDICTED: protein RER1A-like [Nelumbo nucif... 86 2e-16 gb|KRH28427.1| hypothetical protein GLYMA_11G052800 [Glycine max] 86 2e-16 ref|XP_024180808.1| protein RER1A-like [Rosa chinensis] >gi|1358... 86 2e-16 ref|XP_019265220.1| PREDICTED: protein RER1A-like [Nicotiana att... 86 2e-16 ref|XP_009791228.1| PREDICTED: protein RER1A-like [Nicotiana syl... 86 2e-16 ref|XP_019707651.1| PREDICTED: protein RER1A [Elaeis guineensis] 86 3e-16 >ref|XP_020265558.1| protein RER1A-like [Asparagus officinalis] gb|ONK70296.1| uncharacterized protein A4U43_C05F32270 [Asparagus officinalis] Length = 209 Score = 89.7 bits (221), Expect = 1e-17 Identities = 40/52 (76%), Positives = 41/52 (78%) Frame = +1 Query: 388 PFRPSTPRVKFWYLITKVFCIAFVLTFFSAFDVPVFWPILVFYWFVLFHAFM 543 PF P KFWY ITK FCIAF+LTFF AFDVPVFWPILVFYWFVLF A M Sbjct: 124 PFVRRLPEFKFWYSITKAFCIAFILTFFDAFDVPVFWPILVFYWFVLFVATM 175 >ref|XP_003524658.1| PREDICTED: protein RER1A-like [Glycine max] gb|KHN12822.1| Protein RER1A [Glycine soja] gb|KRH57969.1| hypothetical protein GLYMA_05G096900 [Glycine max] Length = 198 Score = 88.2 bits (217), Expect = 3e-17 Identities = 43/82 (52%), Positives = 48/82 (58%), Gaps = 10/82 (12%) Frame = +1 Query: 328 GDLQPSAAPPSTLIRCQAPP----------PFRPSTPRVKFWYLITKVFCIAFVLTFFSA 477 G L P P + ++ P PF P KFWY ITK FCIAFV+TFFSA Sbjct: 80 GFLSPQVDPETVILDADVPTLPSTASDEFRPFVRRLPEFKFWYSITKAFCIAFVMTFFSA 139 Query: 478 FDVPVFWPILVFYWFVLFHAFM 543 FDVPVFWPIL+FYW VLF M Sbjct: 140 FDVPVFWPILLFYWVVLFSLTM 161 >ref|XP_009396419.1| PREDICTED: protein RER1A-like [Musa acuminata subsp. malaccensis] Length = 203 Score = 87.8 bits (216), Expect = 5e-17 Identities = 39/52 (75%), Positives = 40/52 (76%) Frame = +1 Query: 388 PFRPSTPRVKFWYLITKVFCIAFVLTFFSAFDVPVFWPILVFYWFVLFHAFM 543 PF P KFWY ITK FCIAFVLTFFS FDVPVFWPIL+FYWFVLF M Sbjct: 114 PFVRRLPEFKFWYSITKAFCIAFVLTFFSVFDVPVFWPILLFYWFVLFTVTM 165 >ref|XP_009395853.1| PREDICTED: protein RER1A-like [Musa acuminata subsp. malaccensis] Length = 200 Score = 87.4 bits (215), Expect = 6e-17 Identities = 42/74 (56%), Positives = 49/74 (66%), Gaps = 3/74 (4%) Frame = +1 Query: 331 DLQPSAAPPSTLIRCQAPPPFRPST---PRVKFWYLITKVFCIAFVLTFFSAFDVPVFWP 501 ++Q A P + ++ FRP P KFW+ ITK FCIAFVLTFFSAFDVPVFWP Sbjct: 89 EIQDLVAGPGPSLPTRSSDEFRPFVRRLPEFKFWHSITKAFCIAFVLTFFSAFDVPVFWP 148 Query: 502 ILVFYWFVLFHAFM 543 IL+FYW VLF M Sbjct: 149 ILLFYWLVLFTVTM 162 >gb|KMZ72724.1| putative Rer1 protein [Zostera marina] Length = 192 Score = 87.0 bits (214), Expect = 8e-17 Identities = 37/52 (71%), Positives = 41/52 (78%) Frame = +1 Query: 388 PFRPSTPRVKFWYLITKVFCIAFVLTFFSAFDVPVFWPILVFYWFVLFHAFM 543 PF P KFWY ITK FC+AFV+TFFS FDVPVFWPIL+FYWFVLF+ M Sbjct: 104 PFIRRLPEFKFWYSITKAFCMAFVMTFFSVFDVPVFWPILLFYWFVLFYLTM 155 >gb|KHN27074.1| Protein RER1A, partial [Glycine soja] Length = 176 Score = 86.3 bits (212), Expect = 1e-16 Identities = 42/82 (51%), Positives = 47/82 (57%), Gaps = 10/82 (12%) Frame = +1 Query: 328 GDLQPSAAPPSTLIRCQAP----------PPFRPSTPRVKFWYLITKVFCIAFVLTFFSA 477 G L P P + ++ P PF P KFWY ITK FCIAFV+TFFS Sbjct: 56 GFLSPQVDPETAILNADDPILPIAASDEFRPFVRRLPEFKFWYSITKAFCIAFVMTFFSV 115 Query: 478 FDVPVFWPILVFYWFVLFHAFM 543 FDVPVFWPIL+FYW VLF M Sbjct: 116 FDVPVFWPILLFYWVVLFSLTM 137 >ref|XP_009619624.1| PREDICTED: protein RER1A-like [Nicotiana tomentosiformis] ref|XP_016457496.1| PREDICTED: protein RER1A-like [Nicotiana tabacum] Length = 202 Score = 86.7 bits (213), Expect = 1e-16 Identities = 38/48 (79%), Positives = 39/48 (81%) Frame = +1 Query: 388 PFRPSTPRVKFWYLITKVFCIAFVLTFFSAFDVPVFWPILVFYWFVLF 531 PF P KFWY ITK FCIAFVLTFFSAFDVPVFWPIL+FYW VLF Sbjct: 114 PFVRRLPEFKFWYSITKAFCIAFVLTFFSAFDVPVFWPILLFYWIVLF 161 >ref|XP_008799708.1| PREDICTED: protein RER1A-like [Phoenix dactylifera] Length = 204 Score = 86.7 bits (213), Expect = 1e-16 Identities = 38/52 (73%), Positives = 40/52 (76%) Frame = +1 Query: 388 PFRPSTPRVKFWYLITKVFCIAFVLTFFSAFDVPVFWPILVFYWFVLFHAFM 543 PF P KFWY ITK FCIAF+LTFFSAFDVPVFWPIL+FYW VLF M Sbjct: 113 PFVRRLPEFKFWYSITKAFCIAFILTFFSAFDVPVFWPILLFYWLVLFTVTM 164 >dbj|GAU26059.1| hypothetical protein TSUD_225210 [Trifolium subterraneum] Length = 206 Score = 86.7 bits (213), Expect = 1e-16 Identities = 41/69 (59%), Positives = 47/69 (68%), Gaps = 3/69 (4%) Frame = +1 Query: 346 AAPPSTLIRCQAPPPFRPST---PRVKFWYLITKVFCIAFVLTFFSAFDVPVFWPILVFY 516 AA + +A FRP P KFWYLIT+ FCIAFV+TFFSAFD+PVFWPIL+FY Sbjct: 100 AADDGPTLPIRASDEFRPFVRRLPEFKFWYLITQAFCIAFVMTFFSAFDIPVFWPILLFY 159 Query: 517 WFVLFHAFM 543 W VLF M Sbjct: 160 WVVLFSLTM 168 >gb|KHN42107.1| Protein RER1A [Glycine soja] Length = 163 Score = 85.5 bits (210), Expect = 1e-16 Identities = 37/48 (77%), Positives = 39/48 (81%) Frame = +1 Query: 388 PFRPSTPRVKFWYLITKVFCIAFVLTFFSAFDVPVFWPILVFYWFVLF 531 PF P KFWY ITK FCIAFV+TFFSAFDVPVFWPIL+FYW VLF Sbjct: 76 PFVRRLPEFKFWYSITKAFCIAFVMTFFSAFDVPVFWPILLFYWVVLF 123 >gb|KHN36256.1| Protein RER1A [Glycine soja] Length = 163 Score = 85.5 bits (210), Expect = 1e-16 Identities = 37/48 (77%), Positives = 39/48 (81%) Frame = +1 Query: 388 PFRPSTPRVKFWYLITKVFCIAFVLTFFSAFDVPVFWPILVFYWFVLF 531 PF P KFWY ITK FCIAFV+TFFSAFDVPVFWPIL+FYW VLF Sbjct: 76 PFVRRLPEFKFWYSITKAFCIAFVMTFFSAFDVPVFWPILLFYWVVLF 123 >gb|PIN03800.1| Golgi proteins involved in ER retention (RER) [Handroanthus impetiginosus] Length = 195 Score = 86.3 bits (212), Expect = 2e-16 Identities = 39/67 (58%), Positives = 44/67 (65%) Frame = +1 Query: 331 DLQPSAAPPSTLIRCQAPPPFRPSTPRVKFWYLITKVFCIAFVLTFFSAFDVPVFWPILV 510 +L+PS P PF P KFWY ITK FC+AFV+TFFS FDVPVFWPIL+ Sbjct: 88 ELEPSDGPMLPTKGSDEFKPFIRRLPEFKFWYAITKAFCVAFVMTFFSMFDVPVFWPILL 147 Query: 511 FYWFVLF 531 FYW VLF Sbjct: 148 FYWLVLF 154 >ref|XP_003550042.1| PREDICTED: protein RER1A-like [Glycine max] gb|KRH04536.1| hypothetical protein GLYMA_17G168200 [Glycine max] Length = 197 Score = 86.3 bits (212), Expect = 2e-16 Identities = 42/82 (51%), Positives = 47/82 (57%), Gaps = 10/82 (12%) Frame = +1 Query: 328 GDLQPSAAPPSTLIRCQAP----------PPFRPSTPRVKFWYLITKVFCIAFVLTFFSA 477 G L P P + ++ P PF P KFWY ITK FCIAFV+TFFS Sbjct: 77 GFLSPQVDPETAILNADDPILPIAASDEFRPFVRRLPEFKFWYSITKAFCIAFVMTFFSV 136 Query: 478 FDVPVFWPILVFYWFVLFHAFM 543 FDVPVFWPIL+FYW VLF M Sbjct: 137 FDVPVFWPILLFYWVVLFSLTM 158 >ref|XP_021897631.1| protein RER1A-like [Carica papaya] Length = 204 Score = 86.3 bits (212), Expect = 2e-16 Identities = 36/48 (75%), Positives = 40/48 (83%) Frame = +1 Query: 388 PFRPSTPRVKFWYLITKVFCIAFVLTFFSAFDVPVFWPILVFYWFVLF 531 PF P KFWY IT+ FCIAFV+TFFSAFDVPVFWPIL+FYWF+LF Sbjct: 115 PFVRRLPEFKFWYAITRAFCIAFVMTFFSAFDVPVFWPILLFYWFMLF 162 >ref|XP_010270832.1| PREDICTED: protein RER1A-like [Nelumbo nucifera] Length = 205 Score = 86.3 bits (212), Expect = 2e-16 Identities = 37/52 (71%), Positives = 40/52 (76%) Frame = +1 Query: 388 PFRPSTPRVKFWYLITKVFCIAFVLTFFSAFDVPVFWPILVFYWFVLFHAFM 543 PF P KFWY ITK FCIAFV+TFFSAFDVPVFWP+L+FYW VLF M Sbjct: 116 PFVRRLPEFKFWYAITKAFCIAFVMTFFSAFDVPVFWPVLLFYWLVLFFLTM 167 >gb|KRH28427.1| hypothetical protein GLYMA_11G052800 [Glycine max] Length = 191 Score = 85.9 bits (211), Expect = 2e-16 Identities = 43/71 (60%), Positives = 46/71 (64%), Gaps = 7/71 (9%) Frame = +1 Query: 340 PSAAPPSTLIRCQAPPP----FRPST---PRVKFWYLITKVFCIAFVLTFFSAFDVPVFW 498 P P + R P P FRP P KFWY ITK FCIAFV+TFFSAFDVPVFW Sbjct: 81 PLQVDPEIIGRPHPPHPRIRQFRPFVRRLPEFKFWYSITKAFCIAFVMTFFSAFDVPVFW 140 Query: 499 PILVFYWFVLF 531 PIL+FYW VLF Sbjct: 141 PILLFYWVVLF 151 >ref|XP_024180808.1| protein RER1A-like [Rosa chinensis] gb|PRQ48055.1| putative retrieval of early ER protein Rer1 [Rosa chinensis] Length = 199 Score = 85.9 bits (211), Expect = 2e-16 Identities = 37/48 (77%), Positives = 39/48 (81%) Frame = +1 Query: 388 PFRPSTPRVKFWYLITKVFCIAFVLTFFSAFDVPVFWPILVFYWFVLF 531 PF P KFWY ITK FCIAFV+TFFSAFDVPVFWPIL+FYW VLF Sbjct: 118 PFVRRLPEFKFWYSITKAFCIAFVMTFFSAFDVPVFWPILLFYWLVLF 165 >ref|XP_019265220.1| PREDICTED: protein RER1A-like [Nicotiana attenuata] gb|OIT35861.1| protein rer1a [Nicotiana attenuata] Length = 200 Score = 85.9 bits (211), Expect = 2e-16 Identities = 38/52 (73%), Positives = 41/52 (78%) Frame = +1 Query: 388 PFRPSTPRVKFWYLITKVFCIAFVLTFFSAFDVPVFWPILVFYWFVLFHAFM 543 PF P KFWY +TK FCIAFVLTFFSAFDVPVFWPIL+FYW VLF + M Sbjct: 111 PFVRRLPEFKFWYSLTKAFCIAFVLTFFSAFDVPVFWPILLFYWVVLFISTM 162 >ref|XP_009791228.1| PREDICTED: protein RER1A-like [Nicotiana sylvestris] Length = 200 Score = 85.9 bits (211), Expect = 2e-16 Identities = 38/52 (73%), Positives = 41/52 (78%) Frame = +1 Query: 388 PFRPSTPRVKFWYLITKVFCIAFVLTFFSAFDVPVFWPILVFYWFVLFHAFM 543 PF P KFWY +TK FCIAFVLTFFSAFDVPVFWPIL+FYW VLF + M Sbjct: 111 PFVRRLPEFKFWYSLTKAFCIAFVLTFFSAFDVPVFWPILLFYWVVLFISTM 162 >ref|XP_019707651.1| PREDICTED: protein RER1A [Elaeis guineensis] Length = 202 Score = 85.9 bits (211), Expect = 3e-16 Identities = 38/52 (73%), Positives = 40/52 (76%) Frame = +1 Query: 388 PFRPSTPRVKFWYLITKVFCIAFVLTFFSAFDVPVFWPILVFYWFVLFHAFM 543 PF P KFWY ITK FCIAF+LTFFSAFDVPVFWPIL+FYW VLF M Sbjct: 113 PFVRRLPEFKFWYSITKAFCIAFMLTFFSAFDVPVFWPILLFYWLVLFTVTM 164