BLASTX nr result
ID: Ophiopogon27_contig00016108
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00016108 (393 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020256981.1| ethylene-responsive transcription factor 1-l... 61 3e-08 >ref|XP_020256981.1| ethylene-responsive transcription factor 1-like [Asparagus officinalis] Length = 344 Score = 60.8 bits (146), Expect = 3e-08 Identities = 29/47 (61%), Positives = 32/47 (68%) Frame = +3 Query: 162 MCGGAIISGYIPTSAQPRRVTAGDLWLHFRKGKSYGSERKLAKGPTV 302 MCGGAIISG I S PRRVTAGDLW H KG+ YGS++K V Sbjct: 1 MCGGAIISGCISPSNGPRRVTAGDLWPHLSKGQLYGSQKKFVNDRAV 47