BLASTX nr result
ID: Ophiopogon27_contig00015872
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00015872 (638 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010915506.1| PREDICTED: low-temperature-induced cysteine ... 93 2e-18 ref|XP_009404511.1| PREDICTED: cysteine protease XCP1-like [Musa... 92 4e-18 gb|PNX79741.1| cysteine proteinase rd21a-like protein, partial [... 89 4e-18 ref|XP_010277012.1| PREDICTED: low-temperature-induced cysteine ... 92 7e-18 ref|XP_008789986.1| PREDICTED: low-temperature-induced cysteine ... 91 1e-17 ref|XP_013462580.1| cysteine proteinase superfamily protein [Med... 88 1e-17 gb|OAY76262.1| Cysteine proteinase RD21a [Ananas comosus] 90 2e-17 ref|XP_009350090.1| PREDICTED: low-temperature-induced cysteine ... 90 3e-17 ref|XP_006852404.1| low-temperature-induced cysteine proteinase ... 89 5e-17 gb|PPS08553.1| hypothetical protein GOBAR_AA12091 [Gossypium bar... 88 8e-17 ref|XP_020232327.1| low-temperature-induced cysteine proteinase-... 89 9e-17 gb|AAP41846.1| cysteine protease [Anthurium andraeanum] 89 9e-17 ref|XP_013462572.1| papain family cysteine protease [Medicago tr... 88 1e-16 ref|XP_013462564.1| papain family cysteine protease [Medicago tr... 88 1e-16 gb|PON87309.1| Cyseine protease [Trema orientalis] 87 3e-16 gb|PON77007.1| Cysteine Protease [Parasponia andersonii] 87 3e-16 ref|XP_021812003.1| low-temperature-induced cysteine proteinase-... 87 3e-16 gb|OAY83207.1| Cysteine proteinase RD21a [Ananas comosus] 86 3e-16 ref|XP_020988790.1| zingipain-2-like isoform X2 [Arachis duranen... 86 3e-16 ref|XP_004485897.1| PREDICTED: low-temperature-induced cysteine ... 87 4e-16 >ref|XP_010915506.1| PREDICTED: low-temperature-induced cysteine proteinase [Elaeis guineensis] Length = 492 Score = 93.2 bits (230), Expect = 2e-18 Identities = 39/48 (81%), Positives = 44/48 (91%) Frame = -3 Query: 501 GIYDGECSSNPNDIDHAALIVGYTLQGSVNYWIVRNSWGTSWGIQGYI 358 GIYDG+CSSNPNDIDHA LIVGY Q +V+YWIV+NSWGTSWG+QGYI Sbjct: 286 GIYDGDCSSNPNDIDHAVLIVGYGSQDNVDYWIVKNSWGTSWGMQGYI 333 >ref|XP_009404511.1| PREDICTED: cysteine protease XCP1-like [Musa acuminata subsp. malaccensis] Length = 473 Score = 92.4 bits (228), Expect = 4e-18 Identities = 38/48 (79%), Positives = 44/48 (91%) Frame = -3 Query: 501 GIYDGECSSNPNDIDHAALIVGYTLQGSVNYWIVRNSWGTSWGIQGYI 358 GIYDG+CSSNP+DIDHA LIVGY QG V+YWIV+NSWGT+WG+QGYI Sbjct: 283 GIYDGDCSSNPDDIDHAVLIVGYGSQGDVDYWIVKNSWGTTWGMQGYI 330 >gb|PNX79741.1| cysteine proteinase rd21a-like protein, partial [Trifolium pratense] Length = 242 Score = 89.4 bits (220), Expect = 4e-18 Identities = 37/48 (77%), Positives = 42/48 (87%) Frame = -3 Query: 501 GIYDGECSSNPNDIDHAALIVGYTLQGSVNYWIVRNSWGTSWGIQGYI 358 GIYDG CSSNP+DIDHA LIVGY +G +YWIV+NSWGTSWGI+GYI Sbjct: 32 GIYDGNCSSNPDDIDHAVLIVGYGSEGDEDYWIVKNSWGTSWGIEGYI 79 >ref|XP_010277012.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Nelumbo nucifera] Length = 495 Score = 91.7 bits (226), Expect = 7e-18 Identities = 38/48 (79%), Positives = 42/48 (87%) Frame = -3 Query: 501 GIYDGECSSNPNDIDHAALIVGYTLQGSVNYWIVRNSWGTSWGIQGYI 358 GIYDG+CSSNP+DIDHA LIVGY QG YWIV+NSWGTSWGI+GYI Sbjct: 283 GIYDGDCSSNPDDIDHAVLIVGYASQGDEEYWIVKNSWGTSWGIEGYI 330 >ref|XP_008789986.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Phoenix dactylifera] Length = 496 Score = 90.9 bits (224), Expect = 1e-17 Identities = 37/48 (77%), Positives = 44/48 (91%) Frame = -3 Query: 501 GIYDGECSSNPNDIDHAALIVGYTLQGSVNYWIVRNSWGTSWGIQGYI 358 GIY+G+CSSNP+DIDHA LIVGY QG+ +YWIV+NSWGTSWG+QGYI Sbjct: 286 GIYEGDCSSNPDDIDHAVLIVGYGSQGNADYWIVKNSWGTSWGMQGYI 333 >ref|XP_013462580.1| cysteine proteinase superfamily protein [Medicago truncatula] gb|KEH36615.1| cysteine proteinase superfamily protein [Medicago truncatula] Length = 249 Score = 88.2 bits (217), Expect = 1e-17 Identities = 36/48 (75%), Positives = 43/48 (89%) Frame = -3 Query: 501 GIYDGECSSNPNDIDHAALIVGYTLQGSVNYWIVRNSWGTSWGIQGYI 358 GIYDG+CSSNP+DIDHA LIVGY G+ +YWIV+NSWGTSWGI+G+I Sbjct: 65 GIYDGDCSSNPDDIDHAVLIVGYGSDGNQDYWIVKNSWGTSWGIEGFI 112 >gb|OAY76262.1| Cysteine proteinase RD21a [Ananas comosus] Length = 488 Score = 90.1 bits (222), Expect = 2e-17 Identities = 37/48 (77%), Positives = 43/48 (89%) Frame = -3 Query: 501 GIYDGECSSNPNDIDHAALIVGYTLQGSVNYWIVRNSWGTSWGIQGYI 358 GIYDG+CSSNPNDIDHA LIVGY +G +YWIV+NSWGTSWG++GYI Sbjct: 284 GIYDGDCSSNPNDIDHAVLIVGYGSEGGRDYWIVKNSWGTSWGMKGYI 331 >ref|XP_009350090.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Pyrus x bretschneideri] Length = 514 Score = 90.1 bits (222), Expect = 3e-17 Identities = 37/48 (77%), Positives = 42/48 (87%) Frame = -3 Query: 501 GIYDGECSSNPNDIDHAALIVGYTLQGSVNYWIVRNSWGTSWGIQGYI 358 GIYDGECSS+PNDIDHA LIVGY +G +YWIV+NSWGTSWG+ GYI Sbjct: 294 GIYDGECSSDPNDIDHAVLIVGYGSEGDEDYWIVKNSWGTSWGVDGYI 341 >ref|XP_006852404.1| low-temperature-induced cysteine proteinase [Amborella trichopoda] gb|ERN13871.1| hypothetical protein AMTR_s00021p00031000 [Amborella trichopoda] Length = 501 Score = 89.4 bits (220), Expect = 5e-17 Identities = 38/48 (79%), Positives = 41/48 (85%) Frame = -3 Query: 501 GIYDGECSSNPNDIDHAALIVGYTLQGSVNYWIVRNSWGTSWGIQGYI 358 GIYDG CSSNP+DIDHA LIVGY QG +YWIV+NSWGTSWGI GYI Sbjct: 276 GIYDGLCSSNPDDIDHAVLIVGYASQGDEDYWIVKNSWGTSWGINGYI 323 >gb|PPS08553.1| hypothetical protein GOBAR_AA12091 [Gossypium barbadense] Length = 412 Score = 88.2 bits (217), Expect = 8e-17 Identities = 37/51 (72%), Positives = 41/51 (80%) Frame = -3 Query: 513 HLEMGIYDGECSSNPNDIDHAALIVGYTLQGSVNYWIVRNSWGTSWGIQGY 361 H E GIYDG CS +P+DIDHA LIVGY +GS YWIV+NSWGTSWGI GY Sbjct: 304 HEEKGIYDGSCSDDPDDIDHAVLIVGYGSEGSEEYWIVKNSWGTSWGIDGY 354 >ref|XP_020232327.1| low-temperature-induced cysteine proteinase-like [Cajanus cajan] gb|KYP50380.1| Cysteine proteinase RD21a [Cajanus cajan] Length = 501 Score = 88.6 bits (218), Expect = 9e-17 Identities = 36/48 (75%), Positives = 43/48 (89%) Frame = -3 Query: 501 GIYDGECSSNPNDIDHAALIVGYTLQGSVNYWIVRNSWGTSWGIQGYI 358 GIYDG+CSSNP+DIDHA LIVGY +G +YWIV+NSWGTSWG++GYI Sbjct: 284 GIYDGDCSSNPDDIDHAILIVGYGSEGDEDYWIVKNSWGTSWGMEGYI 331 >gb|AAP41846.1| cysteine protease [Anthurium andraeanum] Length = 502 Score = 88.6 bits (218), Expect = 9e-17 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = -3 Query: 501 GIYDGECSSNPNDIDHAALIVGYTLQGSVNYWIVRNSWGTSWGIQGYI 358 GIYDG+CS NP+DIDHA L+VGY QG +YWIV+NSWGT WG+QGYI Sbjct: 293 GIYDGDCSGNPDDIDHAVLVVGYGQQGGTDYWIVKNSWGTDWGMQGYI 340 >ref|XP_013462572.1| papain family cysteine protease [Medicago truncatula] gb|KEH36607.1| papain family cysteine protease [Medicago truncatula] Length = 475 Score = 88.2 bits (217), Expect = 1e-16 Identities = 36/48 (75%), Positives = 43/48 (89%) Frame = -3 Query: 501 GIYDGECSSNPNDIDHAALIVGYTLQGSVNYWIVRNSWGTSWGIQGYI 358 GIYDG+CSSNP+DIDHA LIVGY G+ +YWIV+NSWGTSWGI+G+I Sbjct: 270 GIYDGDCSSNPDDIDHAVLIVGYGSDGNQDYWIVKNSWGTSWGIEGFI 317 >ref|XP_013462564.1| papain family cysteine protease [Medicago truncatula] gb|KEH36599.1| papain family cysteine protease [Medicago truncatula] Length = 490 Score = 88.2 bits (217), Expect = 1e-16 Identities = 36/48 (75%), Positives = 43/48 (89%) Frame = -3 Query: 501 GIYDGECSSNPNDIDHAALIVGYTLQGSVNYWIVRNSWGTSWGIQGYI 358 GIYDG+CSSNP+DIDHA LIVGY G+ +YWIV+NSWGTSWGI+G+I Sbjct: 285 GIYDGDCSSNPDDIDHAVLIVGYGSDGNQDYWIVKNSWGTSWGIEGFI 332 >gb|PON87309.1| Cyseine protease [Trema orientalis] Length = 504 Score = 87.0 bits (214), Expect = 3e-16 Identities = 35/47 (74%), Positives = 41/47 (87%) Frame = -3 Query: 501 GIYDGECSSNPNDIDHAALIVGYTLQGSVNYWIVRNSWGTSWGIQGY 361 GIYDG+CS NP+DIDHA LIVGY +G +YWIV+NSWGTSWGI+GY Sbjct: 290 GIYDGDCSDNPDDIDHAVLIVGYGSEGGEDYWIVKNSWGTSWGIEGY 336 >gb|PON77007.1| Cysteine Protease [Parasponia andersonii] Length = 504 Score = 87.0 bits (214), Expect = 3e-16 Identities = 35/47 (74%), Positives = 41/47 (87%) Frame = -3 Query: 501 GIYDGECSSNPNDIDHAALIVGYTLQGSVNYWIVRNSWGTSWGIQGY 361 GIYDG+CS NP+DIDHA LIVGY +G +YWIV+NSWGTSWGI+GY Sbjct: 290 GIYDGDCSDNPDDIDHAVLIVGYGSEGDEDYWIVKNSWGTSWGIEGY 336 >ref|XP_021812003.1| low-temperature-induced cysteine proteinase-like [Prunus avium] Length = 514 Score = 87.0 bits (214), Expect = 3e-16 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = -3 Query: 501 GIYDGECSSNPNDIDHAALIVGYTLQGSVNYWIVRNSWGTSWGIQGYI 358 GIYDG+CS NP+DIDHA L+VGY +G +YWIV+NSWGTSWGI GYI Sbjct: 295 GIYDGDCSDNPDDIDHAPLVVGYGSEGDEDYWIVKNSWGTSWGIDGYI 342 >gb|OAY83207.1| Cysteine proteinase RD21a [Ananas comosus] Length = 375 Score = 86.3 bits (212), Expect = 3e-16 Identities = 35/48 (72%), Positives = 43/48 (89%) Frame = -3 Query: 501 GIYDGECSSNPNDIDHAALIVGYTLQGSVNYWIVRNSWGTSWGIQGYI 358 GIYDG+CSSNP+DI+HA LIVGY +G +YWIV+NSWGTSWG++GYI Sbjct: 169 GIYDGDCSSNPDDINHAVLIVGYGSEGGRDYWIVKNSWGTSWGMKGYI 216 >ref|XP_020988790.1| zingipain-2-like isoform X2 [Arachis duranensis] Length = 385 Score = 86.3 bits (212), Expect = 3e-16 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = -3 Query: 501 GIYDGECSSNPNDIDHAALIVGYTLQGSVNYWIVRNSWGTSWGIQGYI 358 GIYDG+CSSNP+DIDHA LIVGY +G +YWIV+NSWGT WG+ GYI Sbjct: 173 GIYDGDCSSNPDDIDHAILIVGYGSEGDEDYWIVKNSWGTGWGMDGYI 220 >ref|XP_004485897.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Cicer arietinum] Length = 492 Score = 86.7 bits (213), Expect = 4e-16 Identities = 35/48 (72%), Positives = 43/48 (89%) Frame = -3 Query: 501 GIYDGECSSNPNDIDHAALIVGYTLQGSVNYWIVRNSWGTSWGIQGYI 358 GIYDG+CSS+P+DIDHA LIVGY +G +YWIV+NSWGT+WGI+GYI Sbjct: 281 GIYDGDCSSDPDDIDHAVLIVGYGSKGDEDYWIVKNSWGTNWGIEGYI 328