BLASTX nr result
ID: Ophiopogon27_contig00015356
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00015356 (405 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020260420.1| transcription factor LHW [Asparagus officina... 106 4e-24 >ref|XP_020260420.1| transcription factor LHW [Asparagus officinalis] gb|ONK71337.1| uncharacterized protein A4U43_C04F7440 [Asparagus officinalis] Length = 946 Score = 106 bits (265), Expect = 4e-24 Identities = 65/132 (49%), Positives = 80/132 (60%) Frame = -2 Query: 398 KVNSFPSDTENLRKQCAVSSTTEIPQVFSGTGHSTFNGMLEASHLNSIDKTSHSGSLAEK 219 K NSF S + R Q A SS+TE+PQV + H LE HLNSID HSGSL EK Sbjct: 405 KFNSFASGIGSFRSQHAESSSTELPQVLNPIDH------LEQGHLNSIDTIFHSGSLREK 458 Query: 218 QKSDNGQFQALEAQSTQFVDCDSSYCSVLGNPLEDPVQDNRTLQDSFRIENCGGPAPSRD 39 QKS++GQ+QALE+Q TQ+ + SSY +PL DPVQ N+ Q+S +EN P P+ Sbjct: 459 QKSNDGQYQALESQFTQYDEHGSSY-----SPLLDPVQKNKAHQESPCVENGRDPTPAGS 513 Query: 38 DNKGKVKAEFLQ 3 NK KA LQ Sbjct: 514 GNKSNEKAGNLQ 525