BLASTX nr result
ID: Ophiopogon27_contig00015355
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00015355 (394 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020260420.1| transcription factor LHW [Asparagus officina... 89 8e-18 >ref|XP_020260420.1| transcription factor LHW [Asparagus officinalis] gb|ONK71337.1| uncharacterized protein A4U43_C04F7440 [Asparagus officinalis] Length = 946 Score = 88.6 bits (218), Expect = 8e-18 Identities = 57/130 (43%), Positives = 75/130 (57%) Frame = -3 Query: 392 NGTANIRKQCADSSSTEVAQEVAQGFSGTGHSTFNGMLEPSQLNSIDKTSHSGSSAVKQK 213 +G + R Q A+SSSTE+ Q + + H LE LNSID HSGS KQK Sbjct: 411 SGIGSFRSQHAESSSTELPQVL----NPIDH------LEQGHLNSIDTIFHSGSLREKQK 460 Query: 212 SNNGHFQALEAQSTQFDDYDSSYCSVLGNPLEDPVKDNRTLQDSFRIENCGGPAPSRDDN 33 SN+G +QALE+Q TQ+D++ SSY +PL DPV+ N+ Q+S +EN P P+ N Sbjct: 461 SNDGQYQALESQFTQYDEHGSSY-----SPLLDPVQKNKAHQESPCVENGRDPTPAGSGN 515 Query: 32 KGKLKAEFLQ 3 K KA LQ Sbjct: 516 KSNEKAGNLQ 525