BLASTX nr result
ID: Ophiopogon27_contig00015317
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00015317 (523 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020689442.1| cysteine-rich and transmembrane domain-conta... 55 1e-06 ref|XP_013451619.1| hypothetical protein MTR_6g033295 [Medicago ... 53 7e-06 >ref|XP_020689442.1| cysteine-rich and transmembrane domain-containing protein A-like [Dendrobium catenatum] Length = 107 Score = 54.7 bits (130), Expect = 1e-06 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = -2 Query: 522 PPPPPSEVYYHHHHRGHCGDVSCLSFLRGCMAA 424 PP PPS++YYHHHH H D CLSFLRGC+AA Sbjct: 65 PPQPPSQMYYHHHH--HHEDDGCLSFLRGCLAA 95 >ref|XP_013451619.1| hypothetical protein MTR_6g033295 [Medicago truncatula] gb|KEH25647.1| hypothetical protein MTR_6g033295 [Medicago truncatula] Length = 119 Score = 53.1 bits (126), Expect = 7e-06 Identities = 23/40 (57%), Positives = 25/40 (62%), Gaps = 7/40 (17%) Frame = -2 Query: 522 PPPPPSEVYYH-------HHHRGHCGDVSCLSFLRGCMAA 424 PPPPP+ YH HHH GH GD C SFLRGC+AA Sbjct: 66 PPPPPAPPQYHNYQHVDHHHHHGHHGDPGCCSFLRGCLAA 105