BLASTX nr result
ID: Ophiopogon27_contig00014948
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00014948 (679 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EAY81585.1| hypothetical protein OsI_36751 [Oryza sativa Indi... 66 2e-10 ref|XP_020250374.1| E3 ubiquitin-protein ligase At3g02290-like [... 68 4e-10 gb|KCW87233.1| hypothetical protein EUGRSUZ_B03745 [Eucalyptus g... 66 8e-10 gb|KCW45844.1| hypothetical protein EUGRSUZ_L00304 [Eucalyptus g... 66 8e-10 gb|PKU84031.1| E3 ubiquitin-protein ligase [Dendrobium catenatum] 67 1e-09 ref|XP_018846951.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 67 1e-09 ref|XP_018816765.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 67 1e-09 ref|XP_008672881.1| uncharacterized protein LOC100282797 isoform... 67 1e-09 ref|XP_021905359.1| E3 ubiquitin-protein ligase At3g02290-like [... 64 1e-09 ref|XP_018816767.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 66 2e-09 ref|XP_018816766.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 66 2e-09 gb|ACF86416.1| unknown [Zea mays] >gi|1142684996|gb|AQK48922.1| ... 63 2e-09 ref|XP_022954554.1| E3 ubiquitin-protein ligase At3g02290 [Cucur... 66 2e-09 ref|XP_020687598.1| E3 ubiquitin-protein ligase At3g02290-like [... 65 3e-09 gb|AQK56675.1| RING/U-box superfamily protein [Zea mays] 64 3e-09 ref|XP_010039618.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 66 3e-09 ref|XP_010045080.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 66 3e-09 ref|XP_010525134.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 65 4e-09 ref|XP_022990155.1| E3 ubiquitin-protein ligase At3g02290 isofor... 65 5e-09 ref|XP_018481350.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 65 5e-09 >gb|EAY81585.1| hypothetical protein OsI_36751 [Oryza sativa Indica Group] Length = 100 Score = 65.9 bits (159), Expect = 2e-10 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +1 Query: 268 TYENPRIVLKCCHDFHLGCIYEWKERSELCPVYGRA 375 T ENPRIV++C H FHLGCIYEW ERSE CPV G+A Sbjct: 42 TSENPRIVMQCSHHFHLGCIYEWMERSEACPVCGKA 77 >ref|XP_020250374.1| E3 ubiquitin-protein ligase At3g02290-like [Asparagus officinalis] ref|XP_020250375.1| E3 ubiquitin-protein ligase At3g02290-like [Asparagus officinalis] ref|XP_020250376.1| E3 ubiquitin-protein ligase At3g02290-like [Asparagus officinalis] gb|ONK55146.1| uncharacterized protein A4U43_UnF7090 [Asparagus officinalis] Length = 221 Score = 67.8 bits (164), Expect = 4e-10 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +1 Query: 268 TYENPRIVLKCCHDFHLGCIYEWKERSELCPVYGRAI 378 TYENPRIV+KC H FHL CIYEW+ERSE CPV G+ + Sbjct: 180 TYENPRIVMKCSHHFHLSCIYEWQERSEWCPVCGKVM 216 >gb|KCW87233.1| hypothetical protein EUGRSUZ_B03745 [Eucalyptus grandis] Length = 163 Score = 65.9 bits (159), Expect = 8e-10 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +1 Query: 268 TYENPRIVLKCCHDFHLGCIYEWKERSELCPVYGRAI 378 T ENPRI+ KC H FHLGCIYEWKERS++CPV G+ + Sbjct: 122 TPENPRIMTKCSHHFHLGCIYEWKERSDICPVCGKVM 158 >gb|KCW45844.1| hypothetical protein EUGRSUZ_L00304 [Eucalyptus grandis] Length = 163 Score = 65.9 bits (159), Expect = 8e-10 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +1 Query: 268 TYENPRIVLKCCHDFHLGCIYEWKERSELCPVYGRAI 378 T ENPRI+ KC H FHLGCIYEWKERS++CPV G+ + Sbjct: 122 TPENPRIMTKCSHHFHLGCIYEWKERSDICPVCGKVM 158 >gb|PKU84031.1| E3 ubiquitin-protein ligase [Dendrobium catenatum] Length = 225 Score = 66.6 bits (161), Expect = 1e-09 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +1 Query: 268 TYENPRIVLKCCHDFHLGCIYEWKERSELCPVYGRAI 378 T++NPRI+L+C H FHLGCIYEW ERSELCPV + I Sbjct: 174 TFDNPRIILQCSHHFHLGCIYEWMERSELCPVCSKVI 210 >ref|XP_018846951.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Juglans regia] Length = 228 Score = 66.6 bits (161), Expect = 1e-09 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +1 Query: 268 TYENPRIVLKCCHDFHLGCIYEWKERSELCPVYGRAI 378 T ENP+I+ KCCH FHLGCIYEW ERSE CPV G+ + Sbjct: 186 TQENPKIMTKCCHHFHLGCIYEWMERSESCPVCGKVM 222 >ref|XP_018816765.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like isoform X1 [Juglans regia] Length = 229 Score = 66.6 bits (161), Expect = 1e-09 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +1 Query: 268 TYENPRIVLKCCHDFHLGCIYEWKERSELCPVYGRAI 378 T ENP+I+ KCCH FHLGCIYEW ERSE CPV G+ + Sbjct: 184 TQENPKILTKCCHHFHLGCIYEWMERSESCPVCGKVM 220 >ref|XP_008672881.1| uncharacterized protein LOC100282797 isoform X1 [Zea mays] ref|XP_008672882.1| uncharacterized protein LOC100282797 isoform X1 [Zea mays] gb|ONM34955.1| RING/U-box superfamily protein [Zea mays] Length = 230 Score = 66.6 bits (161), Expect = 1e-09 Identities = 25/44 (56%), Positives = 33/44 (75%) Frame = +1 Query: 268 TYENPRIVLKCCHDFHLGCIYEWKERSELCPVYGRAIWKQKDIA 399 T +NP+I+ KCCH FHLGCIYEW ERS+ CP+ G + ++ IA Sbjct: 183 TPDNPKIITKCCHHFHLGCIYEWMERSDTCPICGNGVLREPMIA 226 >ref|XP_021905359.1| E3 ubiquitin-protein ligase At3g02290-like [Carica papaya] Length = 111 Score = 63.9 bits (154), Expect = 1e-09 Identities = 26/49 (53%), Positives = 34/49 (69%) Frame = +1 Query: 232 VQDFSHPNYLKCTYENPRIVLKCCHDFHLGCIYEWKERSELCPVYGRAI 378 +Q + P + T ENP+I+ KC H FHLGCIYEW ERS+ CPV G+ + Sbjct: 57 IQGYLQPLCTEYTPENPKIMTKCSHHFHLGCIYEWMERSDSCPVCGKVM 105 >ref|XP_018816767.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like isoform X3 [Juglans regia] Length = 224 Score = 66.2 bits (160), Expect = 2e-09 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +1 Query: 268 TYENPRIVLKCCHDFHLGCIYEWKERSELCPVYGR 372 T ENP+I+ KCCH FHLGCIYEW ERSE CPV G+ Sbjct: 184 TQENPKILTKCCHHFHLGCIYEWMERSESCPVCGK 218 >ref|XP_018816766.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like isoform X2 [Juglans regia] Length = 224 Score = 66.2 bits (160), Expect = 2e-09 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +1 Query: 268 TYENPRIVLKCCHDFHLGCIYEWKERSELCPVYGR 372 T ENP+I+ KCCH FHLGCIYEW ERSE CPV G+ Sbjct: 184 TQENPKILTKCCHHFHLGCIYEWMERSESCPVCGK 218 >gb|ACF86416.1| unknown [Zea mays] gb|AQK48922.1| RING/U-box superfamily protein [Zea mays] Length = 102 Score = 63.2 bits (152), Expect = 2e-09 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +1 Query: 274 ENPRIVLKCCHDFHLGCIYEWKERSELCPVYGR 372 ENPRIV++C H FHLGCIYEW ERSE CPV G+ Sbjct: 62 ENPRIVMQCSHHFHLGCIYEWMERSEACPVCGK 94 >ref|XP_022954554.1| E3 ubiquitin-protein ligase At3g02290 [Cucurbita moschata] ref|XP_022954561.1| E3 ubiquitin-protein ligase At3g02290 [Cucurbita moschata] ref|XP_022954569.1| E3 ubiquitin-protein ligase At3g02290 [Cucurbita moschata] ref|XP_023548844.1| E3 ubiquitin-protein ligase At3g02290 [Cucurbita pepo subsp. pepo] ref|XP_023548852.1| E3 ubiquitin-protein ligase At3g02290 [Cucurbita pepo subsp. pepo] ref|XP_023548861.1| E3 ubiquitin-protein ligase At3g02290 [Cucurbita pepo subsp. pepo] ref|XP_023548868.1| E3 ubiquitin-protein ligase At3g02290 [Cucurbita pepo subsp. pepo] Length = 227 Score = 65.9 bits (159), Expect = 2e-09 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +1 Query: 268 TYENPRIVLKCCHDFHLGCIYEWKERSELCPVYGRAI 378 T ENP+IV KCCH FHLGCIYEW ERS+ CPV G+ + Sbjct: 185 TSENPKIVTKCCHHFHLGCIYEWMERSDNCPVCGKVM 221 >ref|XP_020687598.1| E3 ubiquitin-protein ligase At3g02290-like [Dendrobium catenatum] ref|XP_020687599.1| E3 ubiquitin-protein ligase At3g02290-like [Dendrobium catenatum] Length = 216 Score = 65.5 bits (158), Expect = 3e-09 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = +1 Query: 268 TYENPRIVLKCCHDFHLGCIYEWKERSELCPVYGRAI 378 T++NPRI+L+C H FHLGCIYEW ERSELCPV + + Sbjct: 174 TFDNPRIILQCSHHFHLGCIYEWMERSELCPVCSKVM 210 >gb|AQK56675.1| RING/U-box superfamily protein [Zea mays] Length = 143 Score = 63.9 bits (154), Expect = 3e-09 Identities = 23/35 (65%), Positives = 29/35 (82%) Frame = +1 Query: 268 TYENPRIVLKCCHDFHLGCIYEWKERSELCPVYGR 372 T +NP+I+ KCCH FHLGCIYEW ERS+ CP+ G+ Sbjct: 101 TPDNPKIITKCCHHFHLGCIYEWMERSDTCPICGK 135 >ref|XP_010039618.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290 [Eucalyptus grandis] Length = 258 Score = 65.9 bits (159), Expect = 3e-09 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +1 Query: 268 TYENPRIVLKCCHDFHLGCIYEWKERSELCPVYGRAI 378 T ENPRI+ KC H FHLGCIYEWKERS++CPV G+ + Sbjct: 217 TPENPRIMTKCSHHFHLGCIYEWKERSDICPVCGKVM 253 >ref|XP_010045080.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290 [Eucalyptus grandis] Length = 259 Score = 65.9 bits (159), Expect = 3e-09 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +1 Query: 268 TYENPRIVLKCCHDFHLGCIYEWKERSELCPVYGRAI 378 T ENPRI+ KC H FHLGCIYEWKERS++CPV G+ + Sbjct: 218 TPENPRIMTKCSHHFHLGCIYEWKERSDICPVCGKVM 254 >ref|XP_010525134.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290 isoform X1 [Tarenaya hassleriana] Length = 245 Score = 65.5 bits (158), Expect = 4e-09 Identities = 29/44 (65%), Positives = 33/44 (75%), Gaps = 1/44 (2%) Frame = +1 Query: 250 PNYLK-CTYENPRIVLKCCHDFHLGCIYEWKERSELCPVYGRAI 378 P YL+ T ENP+IV KC H FHLGCIYEW ERSE CPV G+ + Sbjct: 196 PTYLEEYTVENPKIVTKCSHHFHLGCIYEWMERSENCPVCGKVM 239 >ref|XP_022990155.1| E3 ubiquitin-protein ligase At3g02290 isoform X2 [Cucurbita maxima] Length = 209 Score = 64.7 bits (156), Expect = 5e-09 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = +1 Query: 268 TYENPRIVLKCCHDFHLGCIYEWKERSELCPVYGRAI 378 T ENP+I+ KCCH FHLGCIYEW ERS+ CPV G+ + Sbjct: 167 TSENPKILTKCCHHFHLGCIYEWMERSDNCPVCGKVM 203 >ref|XP_018481350.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Raphanus sativus] ref|XP_018481362.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Raphanus sativus] Length = 215 Score = 64.7 bits (156), Expect = 5e-09 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = +1 Query: 268 TYENPRIVLKCCHDFHLGCIYEWKERSELCPVYGRAI 378 T ENP+I+ KCCH FHL CIYEW ERSE CPV G+ + Sbjct: 173 TPENPKIITKCCHHFHLSCIYEWMERSETCPVCGKVM 209