BLASTX nr result
ID: Ophiopogon27_contig00014682
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00014682 (571 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTG07134.1| putative clpP, Ser active site protein [Helianthu... 60 2e-07 >gb|OTG07134.1| putative clpP, Ser active site protein [Helianthus annuus] Length = 252 Score = 60.1 bits (144), Expect = 2e-07 Identities = 32/56 (57%), Positives = 37/56 (66%) Frame = -2 Query: 168 YFH*KNGNLLQKKEIGLESTH*FFFHNFFEPYASKDARTVQKGYNFVLINRLYRER 1 Y++ G +KK IG+ + FFF FEPYASK A TV KGYN LINRLYRER Sbjct: 40 YYYKLEGTCYEKKSIGIYTLILFFF---FEPYASKGACTVPKGYNLTLINRLYRER 92