BLASTX nr result
ID: Ophiopogon27_contig00014653
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00014653 (415 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021633407.1| monothiol glutaredoxin-S10 isoform X1 [Manih... 167 3e-50 gb|POF05691.1| glutaredoxin-c5, chloroplastic [Quercus suber] 164 4e-50 ref|XP_021806051.1| glutaredoxin-C5, chloroplastic [Prunus avium] 166 1e-49 ref|XP_021649258.1| glutaredoxin-C5, chloroplastic [Hevea brasil... 165 1e-49 emb|CBI37229.3| unnamed protein product, partial [Vitis vinifera] 163 2e-49 ref|XP_010069686.1| PREDICTED: monothiol glutaredoxin-S10 [Eucal... 165 2e-49 ref|XP_012085184.1| monothiol glutaredoxin-S10 [Jatropha curcas]... 165 2e-49 ref|XP_008789485.1| PREDICTED: monothiol glutaredoxin-S10 [Phoen... 165 2e-49 ref|XP_023916285.1| glutaredoxin-C5, chloroplastic-like isoform ... 164 3e-49 ref|XP_021656377.1| glutaredoxin-C5, chloroplastic-like isoform ... 164 3e-49 ref|XP_011083086.1| monothiol glutaredoxin-S10 [Sesamum indicum] 164 3e-49 dbj|GAV63861.1| Glutaredoxin domain-containing protein [Cephalot... 164 4e-49 ref|XP_019226331.1| PREDICTED: monothiol glutaredoxin-S10-like [... 164 5e-49 ref|XP_009796776.1| PREDICTED: monothiol glutaredoxin-S10-like i... 164 5e-49 gb|OMP09274.1| Glutaredoxin, partial [Corchorus olitorius] 163 5e-49 ref|XP_007050085.1| PREDICTED: monothiol glutaredoxin-S10 isofor... 164 6e-49 ref|XP_021633409.1| glutaredoxin-C5, chloroplastic isoform X2 [M... 162 7e-49 ref|XP_007201404.1| glutaredoxin-C5, chloroplastic [Prunus persi... 163 9e-49 ref|XP_008382672.1| PREDICTED: monothiol glutaredoxin-S10-like i... 163 9e-49 ref|XP_002267052.1| PREDICTED: monothiol glutaredoxin-S10 [Vitis... 163 1e-48 >ref|XP_021633407.1| monothiol glutaredoxin-S10 isoform X1 [Manihot esculenta] gb|OAY32735.1| hypothetical protein MANES_13G042100 [Manihot esculenta] Length = 172 Score = 167 bits (422), Expect = 3e-50 Identities = 77/88 (87%), Positives = 85/88 (96%) Frame = -3 Query: 266 TFGSRLEESVKKTVAENPVVIYSKTWCSYSLEVKSLFKKLGVEPLVIELNELGPQGPQLQ 87 +FGSRLEE++KKTVAENPVV+YSKTWCSYS EVK+LFKKLG EPLVIEL+ELGPQGPQLQ Sbjct: 62 SFGSRLEETIKKTVAENPVVVYSKTWCSYSSEVKTLFKKLGAEPLVIELDELGPQGPQLQ 121 Query: 86 KVLERLTKQHTVPNVFVGGQHIGGCTDT 3 KVLERLT QHTVPNVF+GGQH+GGCTDT Sbjct: 122 KVLERLTGQHTVPNVFIGGQHVGGCTDT 149 >gb|POF05691.1| glutaredoxin-c5, chloroplastic [Quercus suber] Length = 114 Score = 164 bits (416), Expect = 4e-50 Identities = 76/88 (86%), Positives = 85/88 (96%) Frame = -3 Query: 266 TFGSRLEESVKKTVAENPVVIYSKTWCSYSLEVKSLFKKLGVEPLVIELNELGPQGPQLQ 87 +FGSRLEESVKKTVAENP+V+YSKTWCSYS EVK+LFK+LGV+PLVIEL+ELGPQGPQ+Q Sbjct: 4 SFGSRLEESVKKTVAENPIVVYSKTWCSYSSEVKALFKRLGVQPLVIELDELGPQGPQVQ 63 Query: 86 KVLERLTKQHTVPNVFVGGQHIGGCTDT 3 KVLERLT QHTVPNVF+GG HIGGCTDT Sbjct: 64 KVLERLTGQHTVPNVFIGGNHIGGCTDT 91 >ref|XP_021806051.1| glutaredoxin-C5, chloroplastic [Prunus avium] Length = 178 Score = 166 bits (419), Expect = 1e-49 Identities = 78/88 (88%), Positives = 85/88 (96%) Frame = -3 Query: 266 TFGSRLEESVKKTVAENPVVIYSKTWCSYSLEVKSLFKKLGVEPLVIELNELGPQGPQLQ 87 +FGSRLEESVKKTV ENPVV+YSKTWCSYS EVKSLFK+LGVEP+VIEL+ELGPQGPQLQ Sbjct: 68 SFGSRLEESVKKTVDENPVVVYSKTWCSYSSEVKSLFKRLGVEPMVIELDELGPQGPQLQ 127 Query: 86 KVLERLTKQHTVPNVFVGGQHIGGCTDT 3 KVLERLT QHTVPNVF+GG+HIGGCTDT Sbjct: 128 KVLERLTGQHTVPNVFIGGKHIGGCTDT 155 >ref|XP_021649258.1| glutaredoxin-C5, chloroplastic [Hevea brasiliensis] Length = 171 Score = 165 bits (418), Expect = 1e-49 Identities = 77/88 (87%), Positives = 84/88 (95%) Frame = -3 Query: 266 TFGSRLEESVKKTVAENPVVIYSKTWCSYSLEVKSLFKKLGVEPLVIELNELGPQGPQLQ 87 +FGSRLEE+VKKTV ENPVV+YSKTWCSYS EVK+LFKKLG EPLVIEL+E+GPQGPQLQ Sbjct: 61 SFGSRLEETVKKTVVENPVVVYSKTWCSYSSEVKTLFKKLGAEPLVIELDEMGPQGPQLQ 120 Query: 86 KVLERLTKQHTVPNVFVGGQHIGGCTDT 3 KVLERLT QHTVPNVF+GGQHIGGCTDT Sbjct: 121 KVLERLTGQHTVPNVFIGGQHIGGCTDT 148 >emb|CBI37229.3| unnamed protein product, partial [Vitis vinifera] Length = 114 Score = 163 bits (412), Expect = 2e-49 Identities = 76/88 (86%), Positives = 84/88 (95%) Frame = -3 Query: 266 TFGSRLEESVKKTVAENPVVIYSKTWCSYSLEVKSLFKKLGVEPLVIELNELGPQGPQLQ 87 +FGSRLEE+VKKTV ENPVV+YSKTWCSYS EVKSLFK+LGVEP VIEL+E+GPQGPQLQ Sbjct: 4 SFGSRLEETVKKTVDENPVVVYSKTWCSYSSEVKSLFKRLGVEPFVIELDEMGPQGPQLQ 63 Query: 86 KVLERLTKQHTVPNVFVGGQHIGGCTDT 3 KVLERLT QHTVPNVF+GG+HIGGCTDT Sbjct: 64 KVLERLTGQHTVPNVFIGGKHIGGCTDT 91 >ref|XP_010069686.1| PREDICTED: monothiol glutaredoxin-S10 [Eucalyptus grandis] gb|KCW58107.1| hypothetical protein EUGRSUZ_H00830 [Eucalyptus grandis] Length = 182 Score = 165 bits (418), Expect = 2e-49 Identities = 77/88 (87%), Positives = 86/88 (97%) Frame = -3 Query: 266 TFGSRLEESVKKTVAENPVVIYSKTWCSYSLEVKSLFKKLGVEPLVIELNELGPQGPQLQ 87 +FGSRLEE+V+KTVAENPVV+YSK+WCSYS EVKSLFK+LGV+PLVIEL+ELGPQGPQLQ Sbjct: 75 SFGSRLEEAVRKTVAENPVVVYSKSWCSYSSEVKSLFKRLGVDPLVIELDELGPQGPQLQ 134 Query: 86 KVLERLTKQHTVPNVFVGGQHIGGCTDT 3 KVLERLT QHTVPNVF+GGQHIGGCTDT Sbjct: 135 KVLERLTGQHTVPNVFIGGQHIGGCTDT 162 >ref|XP_012085184.1| monothiol glutaredoxin-S10 [Jatropha curcas] gb|KDP26438.1| hypothetical protein JCGZ_17596 [Jatropha curcas] Length = 173 Score = 165 bits (417), Expect = 2e-49 Identities = 77/88 (87%), Positives = 85/88 (96%) Frame = -3 Query: 266 TFGSRLEESVKKTVAENPVVIYSKTWCSYSLEVKSLFKKLGVEPLVIELNELGPQGPQLQ 87 +FGSRLEESVKKTV ENPVV+YSKTWCSYS EVK+LFKKLGV+PLVIEL+ELGPQGPQ+Q Sbjct: 63 SFGSRLEESVKKTVDENPVVVYSKTWCSYSSEVKALFKKLGVDPLVIELDELGPQGPQIQ 122 Query: 86 KVLERLTKQHTVPNVFVGGQHIGGCTDT 3 K+LERLT QHTVPNVF+GGQHIGGCTDT Sbjct: 123 KLLERLTGQHTVPNVFIGGQHIGGCTDT 150 >ref|XP_008789485.1| PREDICTED: monothiol glutaredoxin-S10 [Phoenix dactylifera] Length = 181 Score = 165 bits (417), Expect = 2e-49 Identities = 76/88 (86%), Positives = 87/88 (98%) Frame = -3 Query: 266 TFGSRLEESVKKTVAENPVVIYSKTWCSYSLEVKSLFKKLGVEPLVIELNELGPQGPQLQ 87 +FGSRLEESVKKT++ENPVVIYSKTWCSYS+EVKSLFK++GVEPLVIEL++LGPQGPQLQ Sbjct: 68 SFGSRLEESVKKTISENPVVIYSKTWCSYSMEVKSLFKRIGVEPLVIELDQLGPQGPQLQ 127 Query: 86 KVLERLTKQHTVPNVFVGGQHIGGCTDT 3 KVLERLT Q+TVPNVF+GG+HIGGCTDT Sbjct: 128 KVLERLTGQYTVPNVFIGGKHIGGCTDT 155 >ref|XP_023916285.1| glutaredoxin-C5, chloroplastic-like isoform X1 [Quercus suber] ref|XP_023916286.1| glutaredoxin-C5, chloroplastic-like isoform X2 [Quercus suber] Length = 173 Score = 164 bits (416), Expect = 3e-49 Identities = 76/88 (86%), Positives = 85/88 (96%) Frame = -3 Query: 266 TFGSRLEESVKKTVAENPVVIYSKTWCSYSLEVKSLFKKLGVEPLVIELNELGPQGPQLQ 87 +FGSRLEESVKKTVAENP+V+YSKTWCSYS EVK+LFK+LGV+PLVIEL+ELGPQGPQ+Q Sbjct: 63 SFGSRLEESVKKTVAENPIVVYSKTWCSYSSEVKALFKRLGVQPLVIELDELGPQGPQVQ 122 Query: 86 KVLERLTKQHTVPNVFVGGQHIGGCTDT 3 KVLERLT QHTVPNVF+GG HIGGCTDT Sbjct: 123 KVLERLTGQHTVPNVFIGGNHIGGCTDT 150 >ref|XP_021656377.1| glutaredoxin-C5, chloroplastic-like isoform X1 [Hevea brasiliensis] Length = 176 Score = 164 bits (416), Expect = 3e-49 Identities = 78/88 (88%), Positives = 84/88 (95%) Frame = -3 Query: 266 TFGSRLEESVKKTVAENPVVIYSKTWCSYSLEVKSLFKKLGVEPLVIELNELGPQGPQLQ 87 +FGSRLE+SVKKTVAENPVV+YSKTWCSYS EVK+LFKKLG EPLVIEL+ELGPQGPQLQ Sbjct: 66 SFGSRLEDSVKKTVAENPVVVYSKTWCSYSSEVKTLFKKLGEEPLVIELDELGPQGPQLQ 125 Query: 86 KVLERLTKQHTVPNVFVGGQHIGGCTDT 3 KVLERLT QHTVPNVF+G QHIGGCTDT Sbjct: 126 KVLERLTGQHTVPNVFIGSQHIGGCTDT 153 >ref|XP_011083086.1| monothiol glutaredoxin-S10 [Sesamum indicum] Length = 176 Score = 164 bits (416), Expect = 3e-49 Identities = 75/89 (84%), Positives = 85/89 (95%) Frame = -3 Query: 269 PTFGSRLEESVKKTVAENPVVIYSKTWCSYSLEVKSLFKKLGVEPLVIELNELGPQGPQL 90 P+FGSRLEE+VKKTV ENPVV+YSKTWCSYS EVKSLFK+LGVEP+VIEL++LGPQGPQL Sbjct: 65 PSFGSRLEETVKKTVGENPVVVYSKTWCSYSSEVKSLFKRLGVEPIVIELDQLGPQGPQL 124 Query: 89 QKVLERLTKQHTVPNVFVGGQHIGGCTDT 3 QK LER+T QHTVPNVF+GG+HIGGCTDT Sbjct: 125 QKTLERITGQHTVPNVFIGGKHIGGCTDT 153 >dbj|GAV63861.1| Glutaredoxin domain-containing protein [Cephalotus follicularis] Length = 177 Score = 164 bits (415), Expect = 4e-49 Identities = 77/88 (87%), Positives = 84/88 (95%) Frame = -3 Query: 266 TFGSRLEESVKKTVAENPVVIYSKTWCSYSLEVKSLFKKLGVEPLVIELNELGPQGPQLQ 87 +FGSRLE+SVKKTV ENPVV+YSKTWCSYS EVKSLFKKLGV+PLVIEL+ELGPQGPQ+Q Sbjct: 67 SFGSRLEDSVKKTVEENPVVVYSKTWCSYSSEVKSLFKKLGVQPLVIELDELGPQGPQVQ 126 Query: 86 KVLERLTKQHTVPNVFVGGQHIGGCTDT 3 KVLERLT QHTVPNVF+GG HIGGCTDT Sbjct: 127 KVLERLTGQHTVPNVFIGGNHIGGCTDT 154 >ref|XP_019226331.1| PREDICTED: monothiol glutaredoxin-S10-like [Nicotiana attenuata] Length = 180 Score = 164 bits (415), Expect = 5e-49 Identities = 75/88 (85%), Positives = 85/88 (96%) Frame = -3 Query: 266 TFGSRLEESVKKTVAENPVVIYSKTWCSYSLEVKSLFKKLGVEPLVIELNELGPQGPQLQ 87 +FGSRLEESVKKT+ ENPVV+YSKTWCSYS+EVK+LFKKLGV+PLVIEL+E+GPQGPQLQ Sbjct: 70 SFGSRLEESVKKTITENPVVVYSKTWCSYSMEVKALFKKLGVDPLVIELDEMGPQGPQLQ 129 Query: 86 KVLERLTKQHTVPNVFVGGQHIGGCTDT 3 KVLERLT QHTVPNVF+G +HIGGCTDT Sbjct: 130 KVLERLTGQHTVPNVFIGAKHIGGCTDT 157 >ref|XP_009796776.1| PREDICTED: monothiol glutaredoxin-S10-like isoform X1 [Nicotiana sylvestris] ref|XP_009796777.1| PREDICTED: monothiol glutaredoxin-S10-like isoform X2 [Nicotiana sylvestris] ref|XP_016492604.1| PREDICTED: monothiol glutaredoxin-S10-like isoform X1 [Nicotiana tabacum] ref|XP_016492605.1| PREDICTED: monothiol glutaredoxin-S10-like isoform X2 [Nicotiana tabacum] Length = 180 Score = 164 bits (415), Expect = 5e-49 Identities = 75/88 (85%), Positives = 85/88 (96%) Frame = -3 Query: 266 TFGSRLEESVKKTVAENPVVIYSKTWCSYSLEVKSLFKKLGVEPLVIELNELGPQGPQLQ 87 +FGSRLEESVKKT+ ENPVV+YSKTWCSYS+EVK+LFKKLGV+PLVIEL+E+GPQGPQLQ Sbjct: 70 SFGSRLEESVKKTITENPVVVYSKTWCSYSMEVKALFKKLGVDPLVIELDEMGPQGPQLQ 129 Query: 86 KVLERLTKQHTVPNVFVGGQHIGGCTDT 3 KVLERLT QHTVPNVF+G +HIGGCTDT Sbjct: 130 KVLERLTGQHTVPNVFIGAKHIGGCTDT 157 >gb|OMP09274.1| Glutaredoxin, partial [Corchorus olitorius] Length = 150 Score = 163 bits (412), Expect = 5e-49 Identities = 77/88 (87%), Positives = 85/88 (96%) Frame = -3 Query: 266 TFGSRLEESVKKTVAENPVVIYSKTWCSYSLEVKSLFKKLGVEPLVIELNELGPQGPQLQ 87 +FGSRLE+SVKKTVA+NPVV+YSKTWCSYS EVKSLFKKLGV+PLVIEL+ELG QGPQLQ Sbjct: 42 SFGSRLEDSVKKTVADNPVVVYSKTWCSYSSEVKSLFKKLGVDPLVIELDELGVQGPQLQ 101 Query: 86 KVLERLTKQHTVPNVFVGGQHIGGCTDT 3 KVLERLT QHTVPNVF+GG+HIGGCTDT Sbjct: 102 KVLERLTGQHTVPNVFIGGKHIGGCTDT 129 >ref|XP_007050085.1| PREDICTED: monothiol glutaredoxin-S10 isoform X1 [Theobroma cacao] gb|EOX94242.1| Glutaredoxin family protein isoform 1 [Theobroma cacao] gb|EOX94243.1| Glutaredoxin family protein isoform 1 [Theobroma cacao] Length = 175 Score = 164 bits (414), Expect = 6e-49 Identities = 76/88 (86%), Positives = 85/88 (96%) Frame = -3 Query: 266 TFGSRLEESVKKTVAENPVVIYSKTWCSYSLEVKSLFKKLGVEPLVIELNELGPQGPQLQ 87 +FGSRLEE+VKKTVA+NPVV+YSKTWCSYS EVKSLFK+LGV PLVIEL+ELGPQGPQ+Q Sbjct: 65 SFGSRLEENVKKTVADNPVVVYSKTWCSYSAEVKSLFKRLGVNPLVIELDELGPQGPQVQ 124 Query: 86 KVLERLTKQHTVPNVFVGGQHIGGCTDT 3 KVLERLT QHTVPNVF+GG+HIGGCTDT Sbjct: 125 KVLERLTGQHTVPNVFIGGKHIGGCTDT 152 >ref|XP_021633409.1| glutaredoxin-C5, chloroplastic isoform X2 [Manihot esculenta] Length = 148 Score = 162 bits (411), Expect = 7e-49 Identities = 75/86 (87%), Positives = 83/86 (96%) Frame = -3 Query: 266 TFGSRLEESVKKTVAENPVVIYSKTWCSYSLEVKSLFKKLGVEPLVIELNELGPQGPQLQ 87 +FGSRLEE++KKTVAENPVV+YSKTWCSYS EVK+LFKKLG EPLVIEL+ELGPQGPQLQ Sbjct: 62 SFGSRLEETIKKTVAENPVVVYSKTWCSYSSEVKTLFKKLGAEPLVIELDELGPQGPQLQ 121 Query: 86 KVLERLTKQHTVPNVFVGGQHIGGCT 9 KVLERLT QHTVPNVF+GGQH+GGCT Sbjct: 122 KVLERLTGQHTVPNVFIGGQHVGGCT 147 >ref|XP_007201404.1| glutaredoxin-C5, chloroplastic [Prunus persica] gb|ONH93069.1| hypothetical protein PRUPE_8G210900 [Prunus persica] Length = 178 Score = 163 bits (413), Expect = 9e-49 Identities = 77/88 (87%), Positives = 84/88 (95%) Frame = -3 Query: 266 TFGSRLEESVKKTVAENPVVIYSKTWCSYSLEVKSLFKKLGVEPLVIELNELGPQGPQLQ 87 +FGSRLEESVKKTV ENPVV+YSKTWCSYS EVKSLFK+LGVEP+VIEL+ELGPQGPQLQ Sbjct: 68 SFGSRLEESVKKTVDENPVVVYSKTWCSYSSEVKSLFKRLGVEPMVIELDELGPQGPQLQ 127 Query: 86 KVLERLTKQHTVPNVFVGGQHIGGCTDT 3 KVLERLT QHTVPNVF+ G+HIGGCTDT Sbjct: 128 KVLERLTGQHTVPNVFIAGKHIGGCTDT 155 >ref|XP_008382672.1| PREDICTED: monothiol glutaredoxin-S10-like isoform X1 [Malus domestica] Length = 180 Score = 163 bits (413), Expect = 9e-49 Identities = 77/88 (87%), Positives = 84/88 (95%) Frame = -3 Query: 266 TFGSRLEESVKKTVAENPVVIYSKTWCSYSLEVKSLFKKLGVEPLVIELNELGPQGPQLQ 87 +FGSRLEESVK TV ENPVV+YSKTWCSYS EVKSLFK+LGVEP+VIEL+ELGPQGPQLQ Sbjct: 70 SFGSRLEESVKXTVDENPVVVYSKTWCSYSSEVKSLFKRLGVEPIVIELDELGPQGPQLQ 129 Query: 86 KVLERLTKQHTVPNVFVGGQHIGGCTDT 3 KVLERLT QHTVPNVF+GG+HIGGCTDT Sbjct: 130 KVLERLTGQHTVPNVFIGGKHIGGCTDT 157 >ref|XP_002267052.1| PREDICTED: monothiol glutaredoxin-S10 [Vitis vinifera] Length = 178 Score = 163 bits (412), Expect = 1e-48 Identities = 76/88 (86%), Positives = 84/88 (95%) Frame = -3 Query: 266 TFGSRLEESVKKTVAENPVVIYSKTWCSYSLEVKSLFKKLGVEPLVIELNELGPQGPQLQ 87 +FGSRLEE+VKKTV ENPVV+YSKTWCSYS EVKSLFK+LGVEP VIEL+E+GPQGPQLQ Sbjct: 68 SFGSRLEETVKKTVDENPVVVYSKTWCSYSSEVKSLFKRLGVEPFVIELDEMGPQGPQLQ 127 Query: 86 KVLERLTKQHTVPNVFVGGQHIGGCTDT 3 KVLERLT QHTVPNVF+GG+HIGGCTDT Sbjct: 128 KVLERLTGQHTVPNVFIGGKHIGGCTDT 155