BLASTX nr result
ID: Ophiopogon27_contig00014639
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00014639 (403 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020256574.1| syntaxin-132-like isoform X2 [Asparagus offi... 56 2e-06 ref|XP_020256573.1| syntaxin-132-like isoform X1 [Asparagus offi... 56 2e-06 >ref|XP_020256574.1| syntaxin-132-like isoform X2 [Asparagus officinalis] Length = 297 Score = 55.8 bits (133), Expect = 2e-06 Identities = 34/62 (54%), Positives = 37/62 (59%) Frame = -2 Query: 282 KSVTKASAMKGATFLHQVSPSAP*L*HSGILPALKQRMEKDVNEITKIARHIKTKLEEID 103 KSVTKASAMK ALKQRMEKDVN++ KI R IKTKLEEID Sbjct: 61 KSVTKASAMK----------------------ALKQRMEKDVNDVMKITRSIKTKLEEID 98 Query: 102 QD 97 +D Sbjct: 99 RD 100 >ref|XP_020256573.1| syntaxin-132-like isoform X1 [Asparagus officinalis] Length = 302 Score = 55.8 bits (133), Expect = 2e-06 Identities = 34/62 (54%), Positives = 37/62 (59%) Frame = -2 Query: 282 KSVTKASAMKGATFLHQVSPSAP*L*HSGILPALKQRMEKDVNEITKIARHIKTKLEEID 103 KSVTKASAMK ALKQRMEKDVN++ KI R IKTKLEEID Sbjct: 66 KSVTKASAMK----------------------ALKQRMEKDVNDVMKITRSIKTKLEEID 103 Query: 102 QD 97 +D Sbjct: 104 RD 105