BLASTX nr result
ID: Ophiopogon27_contig00014100
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00014100 (521 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020252465.1| uncharacterized protein At2g39795, mitochond... 70 4e-11 >ref|XP_020252465.1| uncharacterized protein At2g39795, mitochondrial-like [Asparagus officinalis] gb|ONK76888.1| uncharacterized protein A4U43_C02F890 [Asparagus officinalis] Length = 265 Score = 69.7 bits (169), Expect = 4e-11 Identities = 37/59 (62%), Positives = 43/59 (72%) Frame = +2 Query: 344 LRRGATDGLFFPKAAIESRSDLGFFSPQRSNFSTLVAKPTSDAELVKVIESEIQCAEEC 520 L R +DG +A I SR+DLGF PQRS FS+L K SD+ELVKV+ESEIQCAEEC Sbjct: 26 LLRQTSDGRLLQRA-IGSRTDLGFSFPQRSQFSSLALKAASDSELVKVVESEIQCAEEC 83