BLASTX nr result
ID: Ophiopogon27_contig00013603
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00013603 (704 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020273221.1| OTU domain-containing protein DDB_G0284757-l... 94 6e-19 ref|XP_008800530.1| PREDICTED: OTU domain-containing protein DDB... 90 2e-17 ref|XP_008800529.1| PREDICTED: OTU domain-containing protein DDB... 90 2e-17 ref|XP_019709805.1| PREDICTED: OTU domain-containing protein DDB... 90 2e-17 ref|XP_020273225.1| OTU domain-containing protein DDB_G0284757-l... 87 7e-17 ref|XP_020273224.1| OTU domain-containing protein DDB_G0284757-l... 87 2e-16 ref|XP_020273223.1| OTU domain-containing protein DDB_G0284757-l... 87 2e-16 ref|XP_010940618.1| PREDICTED: uncharacterized protein LOC105059... 87 2e-16 ref|XP_020698482.1| OTU domain-containing protein DDB_G0284757-l... 86 3e-16 ref|XP_020276068.1| uncharacterized protein LOC109850456 [Aspara... 87 3e-16 ref|XP_010940616.1| PREDICTED: uncharacterized protein LOC105059... 87 3e-16 gb|PKA58783.1| hypothetical protein AXF42_Ash000876 [Apostasia s... 86 5e-16 ref|XP_020698481.1| uncharacterized protein LOC110111106 isoform... 86 6e-16 ref|XP_020600314.1| uncharacterized protein LOC110039550 isoform... 86 8e-16 ref|XP_020600310.1| uncharacterized protein LOC110039550 isoform... 86 8e-16 ref|XP_020115215.1| uncharacterized protein LOC109729020 isoform... 85 1e-15 gb|OAY67348.1| OTU domain-containing protein [Ananas comosus] 85 2e-15 ref|XP_017696019.1| PREDICTED: uncharacterized protein LOC103696... 84 2e-15 ref|XP_008789561.1| PREDICTED: OTU domain-containing protein DDB... 83 5e-15 ref|XP_008789559.1| PREDICTED: OTU domain-containing protein DDB... 83 7e-15 >ref|XP_020273221.1| OTU domain-containing protein DDB_G0284757-like isoform X2 [Asparagus officinalis] Length = 338 Score = 94.0 bits (232), Expect = 6e-19 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = +2 Query: 2 RSKRVIFLSFWAEVHYNSIYPEGDQPTSETKKKRWWHFGNKH 127 RSKRVIFLSFWAEVHYNSIYPEGD PTSETKKKRWWHFGNK+ Sbjct: 297 RSKRVIFLSFWAEVHYNSIYPEGDMPTSETKKKRWWHFGNKY 338 >ref|XP_008800530.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like isoform X2 [Phoenix dactylifera] Length = 312 Score = 89.7 bits (221), Expect = 2e-17 Identities = 40/43 (93%), Positives = 41/43 (95%), Gaps = 1/43 (2%) Frame = +2 Query: 2 RSKRVIFLSFWAEVHYNSIYPEGDQPTSETK-KKRWWHFGNKH 127 +SKRVIFLSFWAEVHYNSIYPEGD PTSETK KKRWWHFGNKH Sbjct: 270 KSKRVIFLSFWAEVHYNSIYPEGDLPTSETKRKKRWWHFGNKH 312 >ref|XP_008800529.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like isoform X1 [Phoenix dactylifera] Length = 342 Score = 89.7 bits (221), Expect = 2e-17 Identities = 40/43 (93%), Positives = 41/43 (95%), Gaps = 1/43 (2%) Frame = +2 Query: 2 RSKRVIFLSFWAEVHYNSIYPEGDQPTSETK-KKRWWHFGNKH 127 +SKRVIFLSFWAEVHYNSIYPEGD PTSETK KKRWWHFGNKH Sbjct: 300 KSKRVIFLSFWAEVHYNSIYPEGDLPTSETKRKKRWWHFGNKH 342 >ref|XP_019709805.1| PREDICTED: OTU domain-containing protein DDB_G0284757 [Elaeis guineensis] Length = 343 Score = 89.7 bits (221), Expect = 2e-17 Identities = 40/43 (93%), Positives = 41/43 (95%), Gaps = 1/43 (2%) Frame = +2 Query: 2 RSKRVIFLSFWAEVHYNSIYPEGDQPTSET-KKKRWWHFGNKH 127 +SKRVIFLSFWAEVHYNSIYPEGD PTSET KKKRWWHFGNKH Sbjct: 301 KSKRVIFLSFWAEVHYNSIYPEGDLPTSETKKKKRWWHFGNKH 343 >ref|XP_020273225.1| OTU domain-containing protein DDB_G0284757-like isoform X6 [Asparagus officinalis] ref|XP_020273226.1| OTU domain-containing protein DDB_G0284757-like isoform X6 [Asparagus officinalis] ref|XP_020273227.1| OTU domain-containing protein DDB_G0284757-like isoform X6 [Asparagus officinalis] ref|XP_020273228.1| OTU domain-containing protein DDB_G0284757-like isoform X6 [Asparagus officinalis] Length = 238 Score = 86.7 bits (213), Expect = 7e-17 Identities = 39/45 (86%), Positives = 41/45 (91%), Gaps = 3/45 (6%) Frame = +2 Query: 2 RSKRVIFLSFWAEVHYNSIYPEG---DQPTSETKKKRWWHFGNKH 127 RSKRVIFLSFWAEVHYNSIYPEG + PTSETKKKRWWHFGNK+ Sbjct: 194 RSKRVIFLSFWAEVHYNSIYPEGGTSNMPTSETKKKRWWHFGNKY 238 >ref|XP_020273224.1| OTU domain-containing protein DDB_G0284757-like isoform X5 [Asparagus officinalis] Length = 303 Score = 86.7 bits (213), Expect = 2e-16 Identities = 39/45 (86%), Positives = 41/45 (91%), Gaps = 3/45 (6%) Frame = +2 Query: 2 RSKRVIFLSFWAEVHYNSIYPEG---DQPTSETKKKRWWHFGNKH 127 RSKRVIFLSFWAEVHYNSIYPEG + PTSETKKKRWWHFGNK+ Sbjct: 259 RSKRVIFLSFWAEVHYNSIYPEGGTSNMPTSETKKKRWWHFGNKY 303 >ref|XP_020273223.1| OTU domain-containing protein DDB_G0284757-like isoform X4 [Asparagus officinalis] Length = 311 Score = 86.7 bits (213), Expect = 2e-16 Identities = 39/45 (86%), Positives = 41/45 (91%), Gaps = 3/45 (6%) Frame = +2 Query: 2 RSKRVIFLSFWAEVHYNSIYPEG---DQPTSETKKKRWWHFGNKH 127 RSKRVIFLSFWAEVHYNSIYPEG + PTSETKKKRWWHFGNK+ Sbjct: 267 RSKRVIFLSFWAEVHYNSIYPEGGTSNMPTSETKKKRWWHFGNKY 311 >ref|XP_010940618.1| PREDICTED: uncharacterized protein LOC105059106 isoform X2 [Elaeis guineensis] Length = 312 Score = 86.7 bits (213), Expect = 2e-16 Identities = 38/43 (88%), Positives = 41/43 (95%), Gaps = 1/43 (2%) Frame = +2 Query: 2 RSKRVIFLSFWAEVHYNSIYPEGDQPTSETKKK-RWWHFGNKH 127 +SKRV+FLSFWAEVHYNSIYPEGD PTSETKKK RWWHFGNK+ Sbjct: 270 KSKRVMFLSFWAEVHYNSIYPEGDPPTSETKKKRRWWHFGNKY 312 >ref|XP_020698482.1| OTU domain-containing protein DDB_G0284757-like isoform X2 [Dendrobium catenatum] Length = 279 Score = 85.9 bits (211), Expect = 3e-16 Identities = 38/43 (88%), Positives = 39/43 (90%), Gaps = 1/43 (2%) Frame = +2 Query: 2 RSKRVIFLSFWAEVHYNSIYPEGDQPTSETKKK-RWWHFGNKH 127 RSKRVIFLSFWAEVHYNSIYPEGD P +E KKK RWWHFGNKH Sbjct: 237 RSKRVIFLSFWAEVHYNSIYPEGDLPAAEVKKKRRWWHFGNKH 279 >ref|XP_020276068.1| uncharacterized protein LOC109850456 [Asparagus officinalis] ref|XP_020276073.1| uncharacterized protein LOC109850456 [Asparagus officinalis] gb|ONK79496.1| uncharacterized protein A4U43_C01F6950 [Asparagus officinalis] Length = 339 Score = 86.7 bits (213), Expect = 3e-16 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = +2 Query: 2 RSKRVIFLSFWAEVHYNSIYPEGDQPTSETKKKRWWHFGNKH 127 RSKRVIFLSFWAEVHYNSIYPEGD PTSE+KKK WW FGNK+ Sbjct: 298 RSKRVIFLSFWAEVHYNSIYPEGDMPTSESKKKSWWRFGNKN 339 >ref|XP_010940616.1| PREDICTED: uncharacterized protein LOC105059106 isoform X1 [Elaeis guineensis] ref|XP_010940617.1| PREDICTED: uncharacterized protein LOC105059106 isoform X1 [Elaeis guineensis] Length = 343 Score = 86.7 bits (213), Expect = 3e-16 Identities = 38/43 (88%), Positives = 41/43 (95%), Gaps = 1/43 (2%) Frame = +2 Query: 2 RSKRVIFLSFWAEVHYNSIYPEGDQPTSETKKK-RWWHFGNKH 127 +SKRV+FLSFWAEVHYNSIYPEGD PTSETKKK RWWHFGNK+ Sbjct: 301 KSKRVMFLSFWAEVHYNSIYPEGDPPTSETKKKRRWWHFGNKY 343 >gb|PKA58783.1| hypothetical protein AXF42_Ash000876 [Apostasia shenzhenica] Length = 300 Score = 85.5 bits (210), Expect = 5e-16 Identities = 38/43 (88%), Positives = 39/43 (90%), Gaps = 1/43 (2%) Frame = +2 Query: 2 RSKRVIFLSFWAEVHYNSIYPEGDQPTSE-TKKKRWWHFGNKH 127 RSKRVIFLSFWAEVHYNSIYPEGD P +E KKKRWWHFGNKH Sbjct: 258 RSKRVIFLSFWAEVHYNSIYPEGDLPAAEIKKKKRWWHFGNKH 300 >ref|XP_020698481.1| uncharacterized protein LOC110111106 isoform X1 [Dendrobium catenatum] Length = 341 Score = 85.9 bits (211), Expect = 6e-16 Identities = 38/43 (88%), Positives = 39/43 (90%), Gaps = 1/43 (2%) Frame = +2 Query: 2 RSKRVIFLSFWAEVHYNSIYPEGDQPTSETKKK-RWWHFGNKH 127 RSKRVIFLSFWAEVHYNSIYPEGD P +E KKK RWWHFGNKH Sbjct: 299 RSKRVIFLSFWAEVHYNSIYPEGDLPAAEVKKKRRWWHFGNKH 341 >ref|XP_020600314.1| uncharacterized protein LOC110039550 isoform X2 [Phalaenopsis equestris] Length = 338 Score = 85.5 bits (210), Expect = 8e-16 Identities = 38/43 (88%), Positives = 39/43 (90%), Gaps = 1/43 (2%) Frame = +2 Query: 2 RSKRVIFLSFWAEVHYNSIYPEGDQPTSET-KKKRWWHFGNKH 127 RSKRVIFLSFWAEVHYNSIYP GD PT+E KKKRWWHFGNKH Sbjct: 296 RSKRVIFLSFWAEVHYNSIYPAGDLPTAEVKKKKRWWHFGNKH 338 >ref|XP_020600310.1| uncharacterized protein LOC110039550 isoform X1 [Phalaenopsis equestris] ref|XP_020600311.1| uncharacterized protein LOC110039550 isoform X1 [Phalaenopsis equestris] ref|XP_020600312.1| uncharacterized protein LOC110039550 isoform X1 [Phalaenopsis equestris] ref|XP_020600313.1| uncharacterized protein LOC110039550 isoform X1 [Phalaenopsis equestris] Length = 341 Score = 85.5 bits (210), Expect = 8e-16 Identities = 38/43 (88%), Positives = 39/43 (90%), Gaps = 1/43 (2%) Frame = +2 Query: 2 RSKRVIFLSFWAEVHYNSIYPEGDQPTSET-KKKRWWHFGNKH 127 RSKRVIFLSFWAEVHYNSIYP GD PT+E KKKRWWHFGNKH Sbjct: 299 RSKRVIFLSFWAEVHYNSIYPAGDLPTAEVKKKKRWWHFGNKH 341 >ref|XP_020115215.1| uncharacterized protein LOC109729020 isoform X1 [Ananas comosus] ref|XP_020115216.1| uncharacterized protein LOC109729020 isoform X1 [Ananas comosus] Length = 312 Score = 84.7 bits (208), Expect = 1e-15 Identities = 38/43 (88%), Positives = 39/43 (90%), Gaps = 1/43 (2%) Frame = +2 Query: 2 RSKRVIFLSFWAEVHYNSIYPEGDQPTSET-KKKRWWHFGNKH 127 +SKRVIFLSFWAEVHYNSIYPEGD PTS T KKKRWW FGNKH Sbjct: 270 KSKRVIFLSFWAEVHYNSIYPEGDLPTSRTKKKKRWWRFGNKH 312 >gb|OAY67348.1| OTU domain-containing protein [Ananas comosus] Length = 358 Score = 84.7 bits (208), Expect = 2e-15 Identities = 38/43 (88%), Positives = 39/43 (90%), Gaps = 1/43 (2%) Frame = +2 Query: 2 RSKRVIFLSFWAEVHYNSIYPEGDQPTSET-KKKRWWHFGNKH 127 +SKRVIFLSFWAEVHYNSIYPEGD PTS T KKKRWW FGNKH Sbjct: 316 KSKRVIFLSFWAEVHYNSIYPEGDLPTSRTKKKKRWWRFGNKH 358 >ref|XP_017696019.1| PREDICTED: uncharacterized protein LOC103696858 isoform X2 [Phoenix dactylifera] Length = 351 Score = 84.3 bits (207), Expect = 2e-15 Identities = 37/43 (86%), Positives = 40/43 (93%), Gaps = 1/43 (2%) Frame = +2 Query: 2 RSKRVIFLSFWAEVHYNSIYPEGDQPTSET-KKKRWWHFGNKH 127 +SKRVIFLSFWAEVHYNSIYPEG+ PTSE+ KKKRWWHFGN H Sbjct: 309 KSKRVIFLSFWAEVHYNSIYPEGELPTSESKKKKRWWHFGNMH 351 >ref|XP_008789561.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like isoform X2 [Phoenix dactylifera] ref|XP_008789562.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like isoform X2 [Phoenix dactylifera] Length = 312 Score = 82.8 bits (203), Expect = 5e-15 Identities = 37/43 (86%), Positives = 39/43 (90%), Gaps = 1/43 (2%) Frame = +2 Query: 2 RSKRVIFLSFWAEVHYNSIYPEGDQPTSET-KKKRWWHFGNKH 127 +SKRVIFLSFWAEVHYNSIYPE D PT E+ KKKRWWHFGNKH Sbjct: 270 KSKRVIFLSFWAEVHYNSIYPERDLPTLESKKKKRWWHFGNKH 312 >ref|XP_008789559.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like isoform X1 [Phoenix dactylifera] ref|XP_008789560.1| PREDICTED: OTU domain-containing protein DDB_G0284757-like isoform X1 [Phoenix dactylifera] Length = 343 Score = 82.8 bits (203), Expect = 7e-15 Identities = 37/43 (86%), Positives = 39/43 (90%), Gaps = 1/43 (2%) Frame = +2 Query: 2 RSKRVIFLSFWAEVHYNSIYPEGDQPTSET-KKKRWWHFGNKH 127 +SKRVIFLSFWAEVHYNSIYPE D PT E+ KKKRWWHFGNKH Sbjct: 301 KSKRVIFLSFWAEVHYNSIYPERDLPTLESKKKKRWWHFGNKH 343