BLASTX nr result
ID: Ophiopogon27_contig00013224
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00013224 (2353 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020253057.1| LOW QUALITY PROTEIN: ribosomal RNA processin... 68 6e-08 >ref|XP_020253057.1| LOW QUALITY PROTEIN: ribosomal RNA processing protein 1 homolog [Asparagus officinalis] Length = 557 Score = 67.8 bits (164), Expect = 6e-08 Identities = 38/67 (56%), Positives = 45/67 (67%) Frame = -2 Query: 663 NRVLVKKIKANVFEKLAQRGAECLSGEWGGEAEKFGKYALVLGCLEKFSSFNAVAISILF 484 NRVLV KIK NVF++LA G + L+GE E EKFGKYALVLG EKF F + + Sbjct: 202 NRVLVNKIKVNVFDRLAHNGVKFLNGEKNEEVEKFGKYALVLGFSEKF--FKSASDEGTV 259 Query: 483 QGMRRVL 463 QG R+VL Sbjct: 260 QGNRKVL 266