BLASTX nr result
ID: Ophiopogon27_contig00012037
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00012037 (369 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020260670.1| uncharacterized protein LOC109837004 [Aspara... 85 7e-17 >ref|XP_020260670.1| uncharacterized protein LOC109837004 [Asparagus officinalis] gb|ONK71575.1| uncharacterized protein A4U43_C04F10110 [Asparagus officinalis] Length = 359 Score = 84.7 bits (208), Expect = 7e-17 Identities = 40/60 (66%), Positives = 49/60 (81%) Frame = +3 Query: 3 RLKALAAERSSAAPVCQAAVVTTPSAGHCSEEKAWDPLPFKGTGSVLSTEAPAPKANICF 182 R+K LAAERSSAA VC+A V++ + GHCSEEKAW PLPFKG + +S EAPAPKA++CF Sbjct: 301 RMKKLAAERSSAALVCEA-VISNTNTGHCSEEKAWVPLPFKGNDAGISAEAPAPKASVCF 359