BLASTX nr result
ID: Ophiopogon27_contig00011990
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00011990 (1540 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO86887.1| hypothetical protein CISIN_1g0112712mg, partial [... 69 1e-08 ref|XP_010507917.1| PREDICTED: SWR1-complex protein 4 [Camelina ... 68 2e-08 ref|XP_020550336.1| SWR1-complex protein 4 isoform X3 [Sesamum i... 67 2e-08 gb|OEL33086.1| SWR1-complex protein 4 [Dichanthelium oligosanthes] 67 2e-08 ref|XP_018510385.1| PREDICTED: SWR1-complex protein 4-like isofo... 68 2e-08 ref|XP_009118835.1| PREDICTED: SWR1-complex protein 4-like isofo... 68 2e-08 gb|EOA29458.1| hypothetical protein CARUB_v100232611mg, partial ... 65 3e-08 gb|EOX95359.1| Myb-like transcription factor family protein isof... 67 3e-08 ref|XP_021812661.1| SWR1-complex protein 4 isoform X8 [Prunus av... 67 3e-08 ref|XP_021812660.1| SWR1-complex protein 4 isoform X7 [Prunus av... 67 3e-08 ref|XP_021812659.1| SWR1-complex protein 4 isoform X6 [Prunus av... 67 3e-08 ref|XP_020550335.1| SWR1-complex protein 4 isoform X2 [Sesamum i... 67 3e-08 ref|XP_011079518.1| SWR1-complex protein 4 isoform X1 [Sesamum i... 67 3e-08 ref|XP_021812657.1| SWR1-complex protein 4 isoform X5 [Prunus av... 67 3e-08 ref|XP_016649405.1| PREDICTED: SWR1-complex protein 4 isoform X2... 67 3e-08 ref|XP_007051200.2| PREDICTED: SWR1-complex protein 4 [Theobroma... 67 3e-08 gb|EOX95357.1| Myb-like transcription factor family protein isof... 67 3e-08 ref|XP_008227826.1| PREDICTED: SWR1-complex protein 4 isoform X1... 67 3e-08 ref|XP_021812656.1| SWR1-complex protein 4 isoform X4 [Prunus av... 67 3e-08 ref|XP_021812655.1| SWR1-complex protein 4 isoform X3 [Prunus av... 67 3e-08 >gb|KDO86887.1| hypothetical protein CISIN_1g0112712mg, partial [Citrus sinensis] Length = 409 Score = 68.6 bits (166), Expect = 1e-08 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = +2 Query: 1085 FQVRVVNGVPPMSDYSFVKYSKKVDILMYTNGEYENYLTGPVVTR 1219 FQVRVVNGVPP DYSF KY+K VD++ YT+ EYE YLT P+ T+ Sbjct: 127 FQVRVVNGVPPTGDYSFAKYNKSVDVVKYTDEEYEKYLTDPMWTK 171 >ref|XP_010507917.1| PREDICTED: SWR1-complex protein 4 [Camelina sativa] Length = 444 Score = 68.2 bits (165), Expect = 2e-08 Identities = 36/60 (60%), Positives = 41/60 (68%) Frame = +2 Query: 1040 LIFTFS*EWISLKI*FQVRVVNGVPPMSDYSFVKYSKKVDILMYTNGEYENYLTGPVVTR 1219 L FT S LK+ VRVVN VPP DYSF KY+K VDIL YT+ EYEN+LT PV T+ Sbjct: 76 LPFTSSARKDDLKLYHWVRVVNNVPPTGDYSFAKYNKSVDILKYTDEEYENHLTDPVWTK 135 >ref|XP_020550336.1| SWR1-complex protein 4 isoform X3 [Sesamum indicum] Length = 365 Score = 67.4 bits (163), Expect = 2e-08 Identities = 34/60 (56%), Positives = 41/60 (68%) Frame = +2 Query: 1040 LIFTFS*EWISLKI*FQVRVVNGVPPMSDYSFVKYSKKVDILMYTNGEYENYLTGPVVTR 1219 L FT S SL++ VRVVNG+PP DYSF KY+K VD+L YT+ EYE YLT P T+ Sbjct: 73 LPFTNSARKDSLQLYHWVRVVNGIPPTGDYSFAKYNKSVDVLKYTDEEYEKYLTDPAWTK 132 >gb|OEL33086.1| SWR1-complex protein 4 [Dichanthelium oligosanthes] Length = 377 Score = 67.4 bits (163), Expect = 2e-08 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +2 Query: 1088 QVRVVNGVPPMSDYSFVKYSKKVDILMYTNGEYENYLTGPVVTR 1219 +VRVVNGVPP DY F KY+KKVD+L YT+ EYE YL PVV+R Sbjct: 70 KVRVVNGVPPTGDYQFAKYNKKVDVLKYTDEEYEKYLIDPVVSR 113 >ref|XP_018510385.1| PREDICTED: SWR1-complex protein 4-like isoform X2 [Brassica rapa] Length = 466 Score = 67.8 bits (164), Expect = 2e-08 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = +2 Query: 1088 QVRVVNGVPPMSDYSFVKYSKKVDILMYTNGEYENYLTGPVVTR 1219 QVRVVNGVPP +DYSF KY+K VDI YT+ EYEN+LT PV T+ Sbjct: 118 QVRVVNGVPPTADYSFAKYNKSVDISKYTDDEYENHLTDPVWTK 161 >ref|XP_009118835.1| PREDICTED: SWR1-complex protein 4-like isoform X1 [Brassica rapa] Length = 469 Score = 67.8 bits (164), Expect = 2e-08 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = +2 Query: 1088 QVRVVNGVPPMSDYSFVKYSKKVDILMYTNGEYENYLTGPVVTR 1219 QVRVVNGVPP +DYSF KY+K VDI YT+ EYEN+LT PV T+ Sbjct: 118 QVRVVNGVPPTADYSFAKYNKSVDISKYTDDEYENHLTDPVWTK 161 >gb|EOA29458.1| hypothetical protein CARUB_v100232611mg, partial [Capsella rubella] Length = 214 Score = 65.1 bits (157), Expect = 3e-08 Identities = 34/60 (56%), Positives = 40/60 (66%) Frame = +2 Query: 1040 LIFTFS*EWISLKI*FQVRVVNGVPPMSDYSFVKYSKKVDILMYTNGEYENYLTGPVVTR 1219 L FT S L++ RVVN VPP DYSF KY+K VDIL YT+ EYEN+LT PV T+ Sbjct: 76 LPFTSSARKDDLQLYHWARVVNNVPPTGDYSFAKYNKSVDILKYTDEEYENHLTDPVWTK 135 >gb|EOX95359.1| Myb-like transcription factor family protein isoform 3 [Theobroma cacao] Length = 422 Score = 67.4 bits (163), Expect = 3e-08 Identities = 34/60 (56%), Positives = 41/60 (68%) Frame = +2 Query: 1040 LIFTFS*EWISLKI*FQVRVVNGVPPMSDYSFVKYSKKVDILMYTNGEYENYLTGPVVTR 1219 L FT S L++ VRVVNGVPP DYSF KY+K VD++ YT+ EYE YLT PV T+ Sbjct: 73 LPFTSSARKDDLQLYHWVRVVNGVPPTGDYSFAKYNKSVDVIKYTDEEYEKYLTDPVWTK 132 >ref|XP_021812661.1| SWR1-complex protein 4 isoform X8 [Prunus avium] Length = 438 Score = 67.4 bits (163), Expect = 3e-08 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +2 Query: 1040 LIFTFS*EWISLKI*FQVRVVNGVPPMSDYSFVKYSKKVDILMYTNGEYENYLTGPVVTR 1219 L FT S +L++ VRVVNGVPP DYSF KY+K VD++ YT+ EYE YLT P+ TR Sbjct: 73 LPFTSSARKDNLQLYHWVRVVNGVPPTGDYSFAKYNKSVDVVKYTDEEYEKYLTDPMWTR 132 >ref|XP_021812660.1| SWR1-complex protein 4 isoform X7 [Prunus avium] Length = 441 Score = 67.4 bits (163), Expect = 3e-08 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +2 Query: 1040 LIFTFS*EWISLKI*FQVRVVNGVPPMSDYSFVKYSKKVDILMYTNGEYENYLTGPVVTR 1219 L FT S +L++ VRVVNGVPP DYSF KY+K VD++ YT+ EYE YLT P+ TR Sbjct: 73 LPFTSSARKDNLQLYHWVRVVNGVPPTGDYSFAKYNKSVDVVKYTDEEYEKYLTDPMWTR 132 >ref|XP_021812659.1| SWR1-complex protein 4 isoform X6 [Prunus avium] Length = 442 Score = 67.4 bits (163), Expect = 3e-08 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +2 Query: 1040 LIFTFS*EWISLKI*FQVRVVNGVPPMSDYSFVKYSKKVDILMYTNGEYENYLTGPVVTR 1219 L FT S +L++ VRVVNGVPP DYSF KY+K VD++ YT+ EYE YLT P+ TR Sbjct: 73 LPFTSSARKDNLQLYHWVRVVNGVPPTGDYSFAKYNKSVDVVKYTDEEYEKYLTDPMWTR 132 >ref|XP_020550335.1| SWR1-complex protein 4 isoform X2 [Sesamum indicum] Length = 442 Score = 67.4 bits (163), Expect = 3e-08 Identities = 34/60 (56%), Positives = 41/60 (68%) Frame = +2 Query: 1040 LIFTFS*EWISLKI*FQVRVVNGVPPMSDYSFVKYSKKVDILMYTNGEYENYLTGPVVTR 1219 L FT S SL++ VRVVNG+PP DYSF KY+K VD+L YT+ EYE YLT P T+ Sbjct: 73 LPFTNSARKDSLQLYHWVRVVNGIPPTGDYSFAKYNKSVDVLKYTDEEYEKYLTDPAWTK 132 >ref|XP_011079518.1| SWR1-complex protein 4 isoform X1 [Sesamum indicum] ref|XP_020550333.1| SWR1-complex protein 4 isoform X1 [Sesamum indicum] ref|XP_020550334.1| SWR1-complex protein 4 isoform X1 [Sesamum indicum] Length = 443 Score = 67.4 bits (163), Expect = 3e-08 Identities = 34/60 (56%), Positives = 41/60 (68%) Frame = +2 Query: 1040 LIFTFS*EWISLKI*FQVRVVNGVPPMSDYSFVKYSKKVDILMYTNGEYENYLTGPVVTR 1219 L FT S SL++ VRVVNG+PP DYSF KY+K VD+L YT+ EYE YLT P T+ Sbjct: 73 LPFTNSARKDSLQLYHWVRVVNGIPPTGDYSFAKYNKSVDVLKYTDEEYEKYLTDPAWTK 132 >ref|XP_021812657.1| SWR1-complex protein 4 isoform X5 [Prunus avium] Length = 445 Score = 67.4 bits (163), Expect = 3e-08 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +2 Query: 1040 LIFTFS*EWISLKI*FQVRVVNGVPPMSDYSFVKYSKKVDILMYTNGEYENYLTGPVVTR 1219 L FT S +L++ VRVVNGVPP DYSF KY+K VD++ YT+ EYE YLT P+ TR Sbjct: 73 LPFTSSARKDNLQLYHWVRVVNGVPPTGDYSFAKYNKSVDVVKYTDEEYEKYLTDPMWTR 132 >ref|XP_016649405.1| PREDICTED: SWR1-complex protein 4 isoform X2 [Prunus mume] Length = 445 Score = 67.4 bits (163), Expect = 3e-08 Identities = 33/60 (55%), Positives = 42/60 (70%) Frame = +2 Query: 1040 LIFTFS*EWISLKI*FQVRVVNGVPPMSDYSFVKYSKKVDILMYTNGEYENYLTGPVVTR 1219 L FT S +L++ VRVVNGVPP DYSF KY+K VD++ YT+ EYE YLT P+ T+ Sbjct: 73 LPFTSSARKDNLQLYHWVRVVNGVPPTGDYSFAKYNKSVDVVKYTDDEYEKYLTDPIWTK 132 >ref|XP_007051200.2| PREDICTED: SWR1-complex protein 4 [Theobroma cacao] ref|XP_007051201.2| PREDICTED: SWR1-complex protein 4 [Theobroma cacao] Length = 450 Score = 67.4 bits (163), Expect = 3e-08 Identities = 34/60 (56%), Positives = 41/60 (68%) Frame = +2 Query: 1040 LIFTFS*EWISLKI*FQVRVVNGVPPMSDYSFVKYSKKVDILMYTNGEYENYLTGPVVTR 1219 L FT S L++ VRVVNGVPP DYSF KY+K VD++ YT+ EYE YLT PV T+ Sbjct: 73 LPFTSSARKDDLQLYHWVRVVNGVPPTGDYSFAKYNKSVDVIKYTDEEYEKYLTDPVWTK 132 >gb|EOX95357.1| Myb-like transcription factor family protein isoform 1 [Theobroma cacao] gb|EOX95358.1| Myb-like transcription factor family protein isoform 1 [Theobroma cacao] gb|EOX95360.1| Myb-like transcription factor family protein isoform 1 [Theobroma cacao] Length = 450 Score = 67.4 bits (163), Expect = 3e-08 Identities = 34/60 (56%), Positives = 41/60 (68%) Frame = +2 Query: 1040 LIFTFS*EWISLKI*FQVRVVNGVPPMSDYSFVKYSKKVDILMYTNGEYENYLTGPVVTR 1219 L FT S L++ VRVVNGVPP DYSF KY+K VD++ YT+ EYE YLT PV T+ Sbjct: 73 LPFTSSARKDDLQLYHWVRVVNGVPPTGDYSFAKYNKSVDVIKYTDEEYEKYLTDPVWTK 132 >ref|XP_008227826.1| PREDICTED: SWR1-complex protein 4 isoform X1 [Prunus mume] Length = 452 Score = 67.4 bits (163), Expect = 3e-08 Identities = 33/60 (55%), Positives = 42/60 (70%) Frame = +2 Query: 1040 LIFTFS*EWISLKI*FQVRVVNGVPPMSDYSFVKYSKKVDILMYTNGEYENYLTGPVVTR 1219 L FT S +L++ VRVVNGVPP DYSF KY+K VD++ YT+ EYE YLT P+ T+ Sbjct: 73 LPFTSSARKDNLQLYHWVRVVNGVPPTGDYSFAKYNKSVDVVKYTDDEYEKYLTDPIWTK 132 >ref|XP_021812656.1| SWR1-complex protein 4 isoform X4 [Prunus avium] Length = 467 Score = 67.4 bits (163), Expect = 3e-08 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +2 Query: 1040 LIFTFS*EWISLKI*FQVRVVNGVPPMSDYSFVKYSKKVDILMYTNGEYENYLTGPVVTR 1219 L FT S +L++ VRVVNGVPP DYSF KY+K VD++ YT+ EYE YLT P+ TR Sbjct: 73 LPFTSSARKDNLQLYHWVRVVNGVPPTGDYSFAKYNKSVDVVKYTDEEYEKYLTDPMWTR 132 >ref|XP_021812655.1| SWR1-complex protein 4 isoform X3 [Prunus avium] Length = 470 Score = 67.4 bits (163), Expect = 3e-08 Identities = 34/60 (56%), Positives = 42/60 (70%) Frame = +2 Query: 1040 LIFTFS*EWISLKI*FQVRVVNGVPPMSDYSFVKYSKKVDILMYTNGEYENYLTGPVVTR 1219 L FT S +L++ VRVVNGVPP DYSF KY+K VD++ YT+ EYE YLT P+ TR Sbjct: 73 LPFTSSARKDNLQLYHWVRVVNGVPPTGDYSFAKYNKSVDVVKYTDEEYEKYLTDPMWTR 132