BLASTX nr result
ID: Ophiopogon27_contig00011953
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00011953 (619 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK60095.1| uncharacterized protein A4U43_C08F14130 [Asparagu... 138 2e-38 ref|XP_008792748.1| PREDICTED: LOW QUALITY PROTEIN: chaperone pr... 131 1e-31 gb|OAY71448.1| Chaperone protein ClpB3, chloroplastic [Ananas co... 123 9e-31 ref|XP_010936352.2| PREDICTED: chaperone protein ClpB3, chloropl... 128 1e-30 ref|XP_010936351.2| PREDICTED: chaperone protein ClpB3, chloropl... 128 1e-30 gb|OAY80594.1| Chaperone protein ClpB3, chloroplastic [Ananas co... 127 2e-30 ref|XP_009404761.1| PREDICTED: chaperone protein ClpB3, chloropl... 124 2e-29 gb|PIA39486.1| hypothetical protein AQUCO_02600142v1 [Aquilegia ... 124 4e-29 gb|PIA39487.1| hypothetical protein AQUCO_02600142v1 [Aquilegia ... 124 5e-29 ref|XP_020100059.1| chaperone protein ClpB3, chloroplastic [Anan... 123 6e-29 emb|CAN69514.1| hypothetical protein VITISV_009951 [Vitis vinifera] 123 8e-29 emb|CBI22284.3| unnamed protein product, partial [Vitis vinifera] 123 8e-29 ref|XP_002284243.1| PREDICTED: chaperone protein ClpB3, chloropl... 123 8e-29 gb|PKI47944.1| hypothetical protein CRG98_031728, partial [Punic... 112 1e-28 gb|KJB33463.1| hypothetical protein B456_006G011800 [Gossypium r... 122 1e-28 ref|XP_012483524.1| PREDICTED: chaperone protein ClpB3, chloropl... 122 2e-28 gb|AAN17424.1| HSP100/ClpB, putative [Arabidopsis thaliana] >gi|... 114 2e-28 ref|XP_020680522.1| chaperone protein ClpB3, chloroplastic-like ... 120 5e-28 gb|PPD97062.1| hypothetical protein GOBAR_DD05922 [Gossypium bar... 120 7e-28 ref|XP_017611410.1| PREDICTED: chaperone protein ClpB3, chloropl... 120 7e-28 >gb|ONK60095.1| uncharacterized protein A4U43_C08F14130 [Asparagus officinalis] Length = 121 Score = 138 bits (347), Expect = 2e-38 Identities = 70/79 (88%), Positives = 75/79 (94%) Frame = -3 Query: 617 DPNYGARPVKRVIQQNVENEIAKGILRGDFRDESTILVDTELTAFASGQLPQQKLVFRKL 438 DPNYGARPVKRVIQQN+ENEIAKGILRGDF+DE TILVDTELTAF +GQLPQQKLVFRK Sbjct: 43 DPNYGARPVKRVIQQNIENEIAKGILRGDFKDEDTILVDTELTAFLNGQLPQQKLVFRKG 102 Query: 437 NSEASDRPAEEGQKALSPS 381 NS+ASDRPAE+ QKALSPS Sbjct: 103 NSDASDRPAED-QKALSPS 120 >ref|XP_008792748.1| PREDICTED: LOW QUALITY PROTEIN: chaperone protein ClpB3, chloroplastic [Phoenix dactylifera] Length = 984 Score = 131 bits (329), Expect = 1e-31 Identities = 62/79 (78%), Positives = 71/79 (89%) Frame = -3 Query: 617 DPNYGARPVKRVIQQNVENEIAKGILRGDFRDESTILVDTELTAFASGQLPQQKLVFRKL 438 DPNYGARPVKRVIQQNVENE+AKGILRGDF+DE TILVDTE +AF++GQLPQQKLVFR++ Sbjct: 905 DPNYGARPVKRVIQQNVENELAKGILRGDFKDEDTILVDTEFSAFSNGQLPQQKLVFRRV 964 Query: 437 NSEASDRPAEEGQKALSPS 381 N + SDRPA E Q+A PS Sbjct: 965 NPDTSDRPASEDQRAFLPS 983 >gb|OAY71448.1| Chaperone protein ClpB3, chloroplastic [Ananas comosus] Length = 293 Score = 123 bits (309), Expect = 9e-31 Identities = 61/80 (76%), Positives = 70/80 (87%), Gaps = 1/80 (1%) Frame = -3 Query: 617 DPNYGARPVKRVIQQNVENEIAKGILRGDFRDESTILVDTELTAFASGQLPQQKLVFRKL 438 DPNYGARPVKRVIQQ+VENE+AKGILRG+F+DE TI VDTE+ AF++GQLPQQKLVFRKL Sbjct: 213 DPNYGARPVKRVIQQHVENELAKGILRGEFKDEDTISVDTEVMAFSNGQLPQQKLVFRKL 272 Query: 437 NSEASD-RPAEEGQKALSPS 381 N E+S PA EG+KA PS Sbjct: 273 NPESSSGHPASEGEKAFQPS 292 >ref|XP_010936352.2| PREDICTED: chaperone protein ClpB3, chloroplastic isoform X2 [Elaeis guineensis] Length = 992 Score = 128 bits (322), Expect = 1e-30 Identities = 60/79 (75%), Positives = 72/79 (91%) Frame = -3 Query: 617 DPNYGARPVKRVIQQNVENEIAKGILRGDFRDESTILVDTELTAFASGQLPQQKLVFRKL 438 DPNYGARPVKRVIQQNVENE+AKGILRGDF+DE TILVDTE++ F++GQLPQQKLVFR++ Sbjct: 905 DPNYGARPVKRVIQQNVENELAKGILRGDFKDEDTILVDTEVSVFSNGQLPQQKLVFRRV 964 Query: 437 NSEASDRPAEEGQKALSPS 381 + ++SD+PA E QKA PS Sbjct: 965 DPDSSDKPASEDQKAFLPS 983 >ref|XP_010936351.2| PREDICTED: chaperone protein ClpB3, chloroplastic isoform X1 [Elaeis guineensis] Length = 995 Score = 128 bits (322), Expect = 1e-30 Identities = 60/79 (75%), Positives = 72/79 (91%) Frame = -3 Query: 617 DPNYGARPVKRVIQQNVENEIAKGILRGDFRDESTILVDTELTAFASGQLPQQKLVFRKL 438 DPNYGARPVKRVIQQNVENE+AKGILRGDF+DE TILVDTE++ F++GQLPQQKLVFR++ Sbjct: 908 DPNYGARPVKRVIQQNVENELAKGILRGDFKDEDTILVDTEVSVFSNGQLPQQKLVFRRV 967 Query: 437 NSEASDRPAEEGQKALSPS 381 + ++SD+PA E QKA PS Sbjct: 968 DPDSSDKPASEDQKAFLPS 986 >gb|OAY80594.1| Chaperone protein ClpB3, chloroplastic [Ananas comosus] Length = 1036 Score = 127 bits (320), Expect = 2e-30 Identities = 63/80 (78%), Positives = 72/80 (90%), Gaps = 1/80 (1%) Frame = -3 Query: 617 DPNYGARPVKRVIQQNVENEIAKGILRGDFRDESTILVDTELTAFASGQLPQQKLVFRKL 438 DPNYGARPVKRVIQQ+VENE+AKGILRG+F+DE TI VDTE+TAF++GQLPQQKLVFRKL Sbjct: 956 DPNYGARPVKRVIQQHVENELAKGILRGEFKDEDTISVDTEVTAFSNGQLPQQKLVFRKL 1015 Query: 437 NSEASD-RPAEEGQKALSPS 381 N E+S RPA EG+KA PS Sbjct: 1016 NPESSSGRPASEGEKAFQPS 1035 >ref|XP_009404761.1| PREDICTED: chaperone protein ClpB3, chloroplastic [Musa acuminata subsp. malaccensis] Length = 985 Score = 124 bits (312), Expect = 2e-29 Identities = 60/80 (75%), Positives = 72/80 (90%), Gaps = 1/80 (1%) Frame = -3 Query: 617 DPNYGARPVKRVIQQNVENEIAKGILRGDFRDESTILVDTELTAFASGQLPQQKLVFRK- 441 DPNYGARPVKRVIQQNVENE+AKGILRGDF+DE T+LVDTE+T F++GQ PQQKLVFRK Sbjct: 905 DPNYGARPVKRVIQQNVENELAKGILRGDFKDEDTVLVDTEVTVFSNGQRPQQKLVFRKL 964 Query: 440 LNSEASDRPAEEGQKALSPS 381 L++++SD+P+ E QKA PS Sbjct: 965 LDADSSDKPSSEDQKAFLPS 984 >gb|PIA39486.1| hypothetical protein AQUCO_02600142v1 [Aquilegia coerulea] Length = 725 Score = 124 bits (310), Expect = 4e-29 Identities = 60/79 (75%), Positives = 73/79 (92%) Frame = -3 Query: 617 DPNYGARPVKRVIQQNVENEIAKGILRGDFRDESTILVDTELTAFASGQLPQQKLVFRKL 438 DPNYGARPVKRVIQQNVENE+AKGILRG+F+DE TIL+DTE++AFA+GQLPQQKLVF+K+ Sbjct: 646 DPNYGARPVKRVIQQNVENELAKGILRGEFKDEDTILIDTEVSAFANGQLPQQKLVFKKV 705 Query: 437 NSEASDRPAEEGQKALSPS 381 NS+ S+ PAE+ +KA S S Sbjct: 706 NSD-SEAPAEKDEKAFSES 723 >gb|PIA39487.1| hypothetical protein AQUCO_02600142v1 [Aquilegia coerulea] Length = 984 Score = 124 bits (310), Expect = 5e-29 Identities = 60/79 (75%), Positives = 73/79 (92%) Frame = -3 Query: 617 DPNYGARPVKRVIQQNVENEIAKGILRGDFRDESTILVDTELTAFASGQLPQQKLVFRKL 438 DPNYGARPVKRVIQQNVENE+AKGILRG+F+DE TIL+DTE++AFA+GQLPQQKLVF+K+ Sbjct: 905 DPNYGARPVKRVIQQNVENELAKGILRGEFKDEDTILIDTEVSAFANGQLPQQKLVFKKV 964 Query: 437 NSEASDRPAEEGQKALSPS 381 NS+ S+ PAE+ +KA S S Sbjct: 965 NSD-SEAPAEKDEKAFSES 982 >ref|XP_020100059.1| chaperone protein ClpB3, chloroplastic [Ananas comosus] Length = 988 Score = 123 bits (309), Expect = 6e-29 Identities = 61/80 (76%), Positives = 70/80 (87%), Gaps = 1/80 (1%) Frame = -3 Query: 617 DPNYGARPVKRVIQQNVENEIAKGILRGDFRDESTILVDTELTAFASGQLPQQKLVFRKL 438 DPNYGARPVKRVIQQ+VENE+AKGILRG+F+DE TI VDTE+ AF++GQLPQQKLVFRKL Sbjct: 908 DPNYGARPVKRVIQQHVENELAKGILRGEFKDEDTISVDTEVMAFSNGQLPQQKLVFRKL 967 Query: 437 NSEASD-RPAEEGQKALSPS 381 N E+S PA EG+KA PS Sbjct: 968 NPESSSGHPASEGEKAFQPS 987 >emb|CAN69514.1| hypothetical protein VITISV_009951 [Vitis vinifera] Length = 790 Score = 123 bits (308), Expect = 8e-29 Identities = 59/77 (76%), Positives = 70/77 (90%) Frame = -3 Query: 617 DPNYGARPVKRVIQQNVENEIAKGILRGDFRDESTILVDTELTAFASGQLPQQKLVFRKL 438 DPNYGARPVKRVIQQNVENE+AKGILRG+F+DE T+L+DTE+TAF++GQLPQQKL+ RKL Sbjct: 712 DPNYGARPVKRVIQQNVENELAKGILRGEFKDEDTVLIDTEVTAFSNGQLPQQKLILRKL 771 Query: 437 NSEASDRPAEEGQKALS 387 S+ SD PA EGQ+A S Sbjct: 772 ESD-SDTPAAEGQEAFS 787 >emb|CBI22284.3| unnamed protein product, partial [Vitis vinifera] Length = 875 Score = 123 bits (308), Expect = 8e-29 Identities = 59/77 (76%), Positives = 70/77 (90%) Frame = -3 Query: 617 DPNYGARPVKRVIQQNVENEIAKGILRGDFRDESTILVDTELTAFASGQLPQQKLVFRKL 438 DPNYGARPVKRVIQQNVENE+AKGILRG+F+DE T+L+DTE+TAF++GQLPQQKL+ RKL Sbjct: 797 DPNYGARPVKRVIQQNVENELAKGILRGEFKDEDTVLIDTEVTAFSNGQLPQQKLILRKL 856 Query: 437 NSEASDRPAEEGQKALS 387 S+ SD PA EGQ+A S Sbjct: 857 ESD-SDTPAAEGQEAFS 872 >ref|XP_002284243.1| PREDICTED: chaperone protein ClpB3, chloroplastic [Vitis vinifera] Length = 976 Score = 123 bits (308), Expect = 8e-29 Identities = 59/77 (76%), Positives = 70/77 (90%) Frame = -3 Query: 617 DPNYGARPVKRVIQQNVENEIAKGILRGDFRDESTILVDTELTAFASGQLPQQKLVFRKL 438 DPNYGARPVKRVIQQNVENE+AKGILRG+F+DE T+L+DTE+TAF++GQLPQQKL+ RKL Sbjct: 898 DPNYGARPVKRVIQQNVENELAKGILRGEFKDEDTVLIDTEVTAFSNGQLPQQKLILRKL 957 Query: 437 NSEASDRPAEEGQKALS 387 S+ SD PA EGQ+A S Sbjct: 958 ESD-SDTPAAEGQEAFS 973 >gb|PKI47944.1| hypothetical protein CRG98_031728, partial [Punica granatum] Length = 109 Score = 112 bits (281), Expect = 1e-28 Identities = 56/79 (70%), Positives = 68/79 (86%) Frame = -3 Query: 617 DPNYGARPVKRVIQQNVENEIAKGILRGDFRDESTILVDTELTAFASGQLPQQKLVFRKL 438 DPNYGARPVKRVIQQNVENE+AKGILRG+F+DE IL+DTE++AF++GQLPQQKLVFRKL Sbjct: 31 DPNYGARPVKRVIQQNVENELAKGILRGEFKDEDAILIDTEVSAFSNGQLPQQKLVFRKL 90 Query: 437 NSEASDRPAEEGQKALSPS 381 + S E+ +ALSP+ Sbjct: 91 EPD-STTSNEKNIEALSPT 108 >gb|KJB33463.1| hypothetical protein B456_006G011800 [Gossypium raimondii] Length = 725 Score = 122 bits (306), Expect = 1e-28 Identities = 62/77 (80%), Positives = 70/77 (90%) Frame = -3 Query: 617 DPNYGARPVKRVIQQNVENEIAKGILRGDFRDESTILVDTELTAFASGQLPQQKLVFRKL 438 DPNYGARPVKRVIQQNVENE+AKGILRG+F+DE TILVDTELTAFA+GQLPQQKLVF+KL Sbjct: 647 DPNYGARPVKRVIQQNVENELAKGILRGEFKDEDTILVDTELTAFANGQLPQQKLVFKKL 706 Query: 437 NSEASDRPAEEGQKALS 387 N++ SD A Q+ALS Sbjct: 707 NND-SDTQATGSQEALS 722 >ref|XP_012483524.1| PREDICTED: chaperone protein ClpB3, chloroplastic-like [Gossypium raimondii] gb|KJB33461.1| hypothetical protein B456_006G011800 [Gossypium raimondii] Length = 978 Score = 122 bits (306), Expect = 2e-28 Identities = 62/77 (80%), Positives = 70/77 (90%) Frame = -3 Query: 617 DPNYGARPVKRVIQQNVENEIAKGILRGDFRDESTILVDTELTAFASGQLPQQKLVFRKL 438 DPNYGARPVKRVIQQNVENE+AKGILRG+F+DE TILVDTELTAFA+GQLPQQKLVF+KL Sbjct: 900 DPNYGARPVKRVIQQNVENELAKGILRGEFKDEDTILVDTELTAFANGQLPQQKLVFKKL 959 Query: 437 NSEASDRPAEEGQKALS 387 N++ SD A Q+ALS Sbjct: 960 NND-SDTQATGSQEALS 975 >gb|AAN17424.1| HSP100/ClpB, putative [Arabidopsis thaliana] gb|AAO00929.1| HSP100/ClpB, putative [Arabidopsis thaliana] Length = 173 Score = 114 bits (284), Expect = 2e-28 Identities = 52/71 (73%), Positives = 63/71 (88%) Frame = -3 Query: 617 DPNYGARPVKRVIQQNVENEIAKGILRGDFRDESTILVDTELTAFASGQLPQQKLVFRKL 438 DPNYGARPVKRVIQQN+ENE+AKGILRGDF++E IL+DTE+TAF++GQLPQQKL F+K+ Sbjct: 98 DPNYGARPVKRVIQQNIENELAKGILRGDFKEEDGILIDTEVTAFSNGQLPQQKLTFKKI 157 Query: 437 NSEASDRPAEE 405 SE +D EE Sbjct: 158 ESETADAEQEE 168 >ref|XP_020680522.1| chaperone protein ClpB3, chloroplastic-like [Dendrobium catenatum] gb|PKU74915.1| Chaperone protein ClpB3, chloroplastic [Dendrobium catenatum] Length = 948 Score = 120 bits (302), Expect = 5e-28 Identities = 59/79 (74%), Positives = 69/79 (87%) Frame = -3 Query: 617 DPNYGARPVKRVIQQNVENEIAKGILRGDFRDESTILVDTELTAFASGQLPQQKLVFRKL 438 DPNYGARPVKRVIQQNVENE+AKGILRG+F+DE I VDTELTAF++GQLPQQKLVFR+L Sbjct: 869 DPNYGARPVKRVIQQNVENELAKGILRGEFKDEDIIEVDTELTAFSNGQLPQQKLVFRRL 928 Query: 437 NSEASDRPAEEGQKALSPS 381 +SD+P+ E Q+AL S Sbjct: 929 EPGSSDQPSTENQEALLSS 947 >gb|PPD97062.1| hypothetical protein GOBAR_DD05922 [Gossypium barbadense] Length = 938 Score = 120 bits (301), Expect = 7e-28 Identities = 61/77 (79%), Positives = 69/77 (89%) Frame = -3 Query: 617 DPNYGARPVKRVIQQNVENEIAKGILRGDFRDESTILVDTELTAFASGQLPQQKLVFRKL 438 DPNYGARPVKRVIQQNVENE+AKGILRG+F+DE TILVD ELTAFA+GQLPQQKLVF+KL Sbjct: 860 DPNYGARPVKRVIQQNVENELAKGILRGEFKDEDTILVDNELTAFANGQLPQQKLVFKKL 919 Query: 437 NSEASDRPAEEGQKALS 387 N++ SD A Q+ALS Sbjct: 920 NND-SDTQATGSQEALS 935 >ref|XP_017611410.1| PREDICTED: chaperone protein ClpB3, chloroplastic [Gossypium arboreum] Length = 969 Score = 120 bits (301), Expect = 7e-28 Identities = 61/77 (79%), Positives = 70/77 (90%) Frame = -3 Query: 617 DPNYGARPVKRVIQQNVENEIAKGILRGDFRDESTILVDTELTAFASGQLPQQKLVFRKL 438 DPNYGARPVKRVIQQNVENE+AKGILRG+F+DE TILVDTELTAFA+GQLPQQKLVF+KL Sbjct: 891 DPNYGARPVKRVIQQNVENELAKGILRGEFKDEDTILVDTELTAFANGQLPQQKLVFKKL 950 Query: 437 NSEASDRPAEEGQKALS 387 +++ SD A Q+ALS Sbjct: 951 DND-SDTQATGSQEALS 966