BLASTX nr result
ID: Ophiopogon27_contig00011907
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00011907 (568 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020241391.1| homeobox-leucine zipper protein HOX6-like [A... 78 4e-14 >ref|XP_020241391.1| homeobox-leucine zipper protein HOX6-like [Asparagus officinalis] gb|ONK58841.1| uncharacterized protein A4U43_C08F290 [Asparagus officinalis] Length = 224 Score = 77.8 bits (190), Expect = 4e-14 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = -1 Query: 565 KETEDFFSEPPIGGGSLVPSEQQQFCFHQPSWPPDQSCATSQWWEF 428 ++ +DFFS PP GG SLVPSEQQ FCFHQPSWP DQ+CA SQWWEF Sbjct: 176 EKEKDFFSGPPTGG-SLVPSEQQ-FCFHQPSWPTDQACANSQWWEF 219