BLASTX nr result
ID: Ophiopogon27_contig00011873
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00011873 (382 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020273170.1| anthranilate synthase beta subunit 1, chloro... 61 2e-08 >ref|XP_020273170.1| anthranilate synthase beta subunit 1, chloroplastic-like [Asparagus officinalis] gb|ONK65332.1| uncharacterized protein A4U43_C07F36030 [Asparagus officinalis] Length = 271 Score = 61.2 bits (147), Expect = 2e-08 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 203 GVRVPAAERKEERSIIVIDNYDSFTYNLCQY 295 GVRVP ERKEER I+V+DNYDSFTYNLCQY Sbjct: 55 GVRVPVVERKEERPIVVVDNYDSFTYNLCQY 85