BLASTX nr result
ID: Ophiopogon27_contig00011700
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00011700 (547 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020101295.1| vacuolar-sorting receptor 1-like [Ananas com... 77 4e-13 ref|XP_008792241.1| PREDICTED: vacuolar-sorting receptor 1-like ... 76 8e-13 ref|XP_010931377.1| PREDICTED: vacuolar-sorting receptor 1-like ... 75 1e-12 ref|XP_010922756.1| PREDICTED: vacuolar-sorting receptor 1 [Elae... 75 1e-12 ref|XP_008788526.1| PREDICTED: vacuolar-sorting receptor 1-like ... 75 1e-12 ref|XP_020252085.1| vacuolar-sorting receptor 1-like [Asparagus ... 72 2e-11 ref|XP_020693293.1| vacuolar-sorting receptor 1 [Dendrobium cate... 72 2e-11 gb|ONK77165.1| uncharacterized protein A4U43_C02F3770 [Asparagus... 72 2e-11 gb|PKA51851.1| Vacuolar-sorting receptor 1 [Apostasia shenzhenica] 71 6e-11 ref|XP_009384326.1| PREDICTED: vacuolar-sorting receptor 1-like ... 69 3e-10 ref|XP_020277040.1| vacuolar-sorting receptor 1-like [Asparagus ... 67 2e-09 gb|PKA61785.1| Vacuolar-sorting receptor 1 [Apostasia shenzhenica] 64 1e-08 ref|XP_020108439.1| vacuolar-sorting receptor 1-like [Ananas com... 63 3e-08 gb|OAY79951.1| Vacuolar-sorting receptor 1 [Ananas comosus] 63 3e-08 ref|XP_020689381.1| vacuolar-sorting receptor 1-like isoform X2 ... 62 5e-08 ref|XP_020689379.1| vacuolar-sorting receptor 1-like isoform X1 ... 62 5e-08 ref|XP_010252051.1| PREDICTED: vacuolar-sorting receptor 1-like ... 62 6e-08 gb|OMP04807.1| hypothetical protein COLO4_09277 [Corchorus olito... 61 1e-07 ref|XP_010253066.1| PREDICTED: vacuolar-sorting receptor 1-like ... 61 1e-07 ref|XP_010253065.1| PREDICTED: vacuolar-sorting receptor 1-like ... 61 1e-07 >ref|XP_020101295.1| vacuolar-sorting receptor 1-like [Ananas comosus] gb|OAY84296.1| Vacuolar-sorting receptor 1 [Ananas comosus] Length = 620 Score = 77.0 bits (188), Expect = 4e-13 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = -3 Query: 119 MRGKLWLCVWVLFLWGSCSGRFVVEKNSLKVTSPESLKG 3 MRGKLW +WVLFLWGSC GRFVVEKNSLKVTSPE LKG Sbjct: 1 MRGKLWFSIWVLFLWGSCWGRFVVEKNSLKVTSPEDLKG 39 >ref|XP_008792241.1| PREDICTED: vacuolar-sorting receptor 1-like [Phoenix dactylifera] Length = 620 Score = 76.3 bits (186), Expect = 8e-13 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = -3 Query: 119 MRGKLWLCVWVLFLWGSCSGRFVVEKNSLKVTSPESLKG 3 MRGKLW+ VWVLFLWGS GRFVVEKNSLKVTSPESLKG Sbjct: 1 MRGKLWISVWVLFLWGSSLGRFVVEKNSLKVTSPESLKG 39 >ref|XP_010931377.1| PREDICTED: vacuolar-sorting receptor 1-like [Elaeis guineensis] Length = 620 Score = 75.5 bits (184), Expect = 1e-12 Identities = 35/39 (89%), Positives = 35/39 (89%) Frame = -3 Query: 119 MRGKLWLCVWVLFLWGSCSGRFVVEKNSLKVTSPESLKG 3 MRGKLW VWVLFLWGS GRFVVEKNSLKVTSPESLKG Sbjct: 1 MRGKLWFSVWVLFLWGSSFGRFVVEKNSLKVTSPESLKG 39 >ref|XP_010922756.1| PREDICTED: vacuolar-sorting receptor 1 [Elaeis guineensis] Length = 620 Score = 75.5 bits (184), Expect = 1e-12 Identities = 35/39 (89%), Positives = 35/39 (89%) Frame = -3 Query: 119 MRGKLWLCVWVLFLWGSCSGRFVVEKNSLKVTSPESLKG 3 MRGKLW VWVLFLWGS GRFVVEKNSLKVTSPESLKG Sbjct: 1 MRGKLWFSVWVLFLWGSSLGRFVVEKNSLKVTSPESLKG 39 >ref|XP_008788526.1| PREDICTED: vacuolar-sorting receptor 1-like [Phoenix dactylifera] Length = 624 Score = 75.5 bits (184), Expect = 1e-12 Identities = 35/39 (89%), Positives = 35/39 (89%) Frame = -3 Query: 119 MRGKLWLCVWVLFLWGSCSGRFVVEKNSLKVTSPESLKG 3 MRGKLW VWVLFLWGS GRFVVEKNSLKVTSPESLKG Sbjct: 5 MRGKLWFSVWVLFLWGSSLGRFVVEKNSLKVTSPESLKG 43 >ref|XP_020252085.1| vacuolar-sorting receptor 1-like [Asparagus officinalis] Length = 622 Score = 72.0 bits (175), Expect = 2e-11 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = -3 Query: 119 MRGKLWLCVWVLFLWGSCSGRFVVEKNSLKVTSPESLKG 3 MRG LW +W L LWGSC GRFVVEKNSLKVTSPESL+G Sbjct: 1 MRGNLWFSIWALLLWGSCLGRFVVEKNSLKVTSPESLRG 39 >ref|XP_020693293.1| vacuolar-sorting receptor 1 [Dendrobium catenatum] gb|PKU74479.1| Vacuolar-sorting receptor 1 [Dendrobium catenatum] Length = 630 Score = 72.0 bits (175), Expect = 2e-11 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = -3 Query: 128 GAKMRGKLWLCVWVLFLWGSCSGRFVVEKNSLKVTSPESLKG 3 G +MR K+W VWVLFL+GSC GRFVVEKNSL+VTSP++LKG Sbjct: 4 GTRMRDKMWFSVWVLFLFGSCCGRFVVEKNSLRVTSPDALKG 45 >gb|ONK77165.1| uncharacterized protein A4U43_C02F3770 [Asparagus officinalis] Length = 688 Score = 72.0 bits (175), Expect = 2e-11 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = -3 Query: 119 MRGKLWLCVWVLFLWGSCSGRFVVEKNSLKVTSPESLKG 3 MRG LW +W L LWGSC GRFVVEKNSLKVTSPESL+G Sbjct: 1 MRGNLWFSIWALLLWGSCLGRFVVEKNSLKVTSPESLRG 39 >gb|PKA51851.1| Vacuolar-sorting receptor 1 [Apostasia shenzhenica] Length = 578 Score = 70.9 bits (172), Expect = 6e-11 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -3 Query: 119 MRGKLWLCVWVLFLWGSCSGRFVVEKNSLKVTSPESLKG 3 MRGK+ +CVW LFL+GSC GRFVVEKNSLKVTSPESLKG Sbjct: 1 MRGKVRVCVWFLFLFGSCWGRFVVEKNSLKVTSPESLKG 39 >ref|XP_009384326.1| PREDICTED: vacuolar-sorting receptor 1-like [Musa acuminata subsp. malaccensis] Length = 621 Score = 68.9 bits (167), Expect = 3e-10 Identities = 35/44 (79%), Positives = 38/44 (86%), Gaps = 1/44 (2%) Frame = -3 Query: 131 LGAKMRGKLWLCVWVLFL-WGSCSGRFVVEKNSLKVTSPESLKG 3 +GAKM LW+ VWVLFL WGSC GRFVVEKNSLKVTSP+SLKG Sbjct: 1 MGAKM---LWISVWVLFLLWGSCWGRFVVEKNSLKVTSPDSLKG 41 >ref|XP_020277040.1| vacuolar-sorting receptor 1-like [Asparagus officinalis] gb|ONK61774.1| uncharacterized protein A4U43_C08F33450 [Asparagus officinalis] Length = 624 Score = 66.6 bits (161), Expect = 2e-09 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = -3 Query: 119 MRGKLWLCVWVLFLWGSCSGRFVVEKNSLKVTSPESLKG 3 MR KL +WVLFLWGS GRFVVEKNSLKVTSPE+LKG Sbjct: 1 MRAKLCFLIWVLFLWGSSLGRFVVEKNSLKVTSPETLKG 39 >gb|PKA61785.1| Vacuolar-sorting receptor 1 [Apostasia shenzhenica] Length = 623 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -3 Query: 119 MRGKLWLCVWVLFLWGSCSGRFVVEKNSLKVTSPESLK 6 MR LW C+WV FL GSC GRFVVEK+SL+VTSP+SLK Sbjct: 1 MRAGLWFCIWVSFLLGSCVGRFVVEKSSLRVTSPDSLK 38 >ref|XP_020108439.1| vacuolar-sorting receptor 1-like [Ananas comosus] Length = 624 Score = 62.8 bits (151), Expect = 3e-08 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = -3 Query: 119 MRGKLWLCVWVLFLWGSCSGRFVVEKNSLKVTSPESLK 6 MRGKLW+ +W+ FL GSC G+F+VEKNSL+VTSP+ LK Sbjct: 2 MRGKLWISIWISFLLGSCMGKFMVEKNSLRVTSPKYLK 39 >gb|OAY79951.1| Vacuolar-sorting receptor 1 [Ananas comosus] Length = 624 Score = 62.8 bits (151), Expect = 3e-08 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = -3 Query: 119 MRGKLWLCVWVLFLWGSCSGRFVVEKNSLKVTSPESLK 6 MRGKLW+ +W+ FL GSC G+F+VEKNSL+VTSP+ LK Sbjct: 2 MRGKLWISIWISFLLGSCMGKFMVEKNSLRVTSPKYLK 39 >ref|XP_020689381.1| vacuolar-sorting receptor 1-like isoform X2 [Dendrobium catenatum] Length = 623 Score = 62.4 bits (150), Expect = 5e-08 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -3 Query: 125 AKMRGKLWLCVWVLFLWGSCSGRFVVEKNSLKVTSPESLKG 3 A+M K+ VW L +WGSC GRFVVEKNSLKVTSP++LKG Sbjct: 5 ARMSRKICFLVWFLIVWGSCWGRFVVEKNSLKVTSPDTLKG 45 >ref|XP_020689379.1| vacuolar-sorting receptor 1-like isoform X1 [Dendrobium catenatum] ref|XP_020689380.1| vacuolar-sorting receptor 1-like isoform X1 [Dendrobium catenatum] gb|PKU78077.1| Vacuolar-sorting receptor 1 [Dendrobium catenatum] Length = 630 Score = 62.4 bits (150), Expect = 5e-08 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -3 Query: 125 AKMRGKLWLCVWVLFLWGSCSGRFVVEKNSLKVTSPESLKG 3 A+M K+ VW L +WGSC GRFVVEKNSLKVTSP++LKG Sbjct: 5 ARMSRKICFLVWFLIVWGSCWGRFVVEKNSLKVTSPDTLKG 45 >ref|XP_010252051.1| PREDICTED: vacuolar-sorting receptor 1-like [Nelumbo nucifera] Length = 624 Score = 62.0 bits (149), Expect = 6e-08 Identities = 30/40 (75%), Positives = 32/40 (80%), Gaps = 1/40 (2%) Frame = -3 Query: 119 MRGKLW-LCVWVLFLWGSCSGRFVVEKNSLKVTSPESLKG 3 MR KL + +W LF WGSC GRFVVEKNSLKVTSPE LKG Sbjct: 1 MREKLLPIFIWALFFWGSCLGRFVVEKNSLKVTSPEDLKG 40 >gb|OMP04807.1| hypothetical protein COLO4_09277 [Corchorus olitorius] Length = 485 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -3 Query: 107 LWLCVWVLFLWGSCSGRFVVEKNSLKVTSPESLKG 3 L +CVW++ LWG C GRFVVEKNSLK+ SPES+KG Sbjct: 7 LMICVWMILLWGKCLGRFVVEKNSLKLISPESIKG 41 >ref|XP_010253066.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Nelumbo nucifera] Length = 580 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = -3 Query: 119 MRGKLWLCVWVLFLWGSCSGRFVVEKNSLKVTSPESLKG 3 MR KL +W LFL GSC GRFVVEKNSL+VTSP+SLKG Sbjct: 1 MREKLRFFIWALFLCGSCLGRFVVEKNSLRVTSPQSLKG 39 >ref|XP_010253065.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nelumbo nucifera] Length = 623 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = -3 Query: 119 MRGKLWLCVWVLFLWGSCSGRFVVEKNSLKVTSPESLKG 3 MR KL +W LFL GSC GRFVVEKNSL+VTSP+SLKG Sbjct: 1 MREKLRFFIWALFLCGSCLGRFVVEKNSLRVTSPQSLKG 39