BLASTX nr result
ID: Ophiopogon27_contig00011229
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00011229 (2888 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACZ72942.1| F1 ATPase beta subunit, partial [Corchorus capsul... 76 1e-12 gb|KMS98665.1| hypothetical protein BVRB_3g069750 [Beta vulgaris... 76 2e-12 gb|PHT34495.1| ATP synthase subunit beta, chloroplastic [Capsicu... 76 2e-12 gb|PKA46425.1| ATP synthase subunit beta, chloroplastic [Apostas... 75 2e-12 gb|OMP13146.1| hypothetical protein COLO4_02195 [Corchorus olito... 76 3e-12 gb|AAT57700.1| ATP synthase beta chain, partial (chloroplast) [P... 76 3e-12 gb|EYU36961.1| hypothetical protein MIMGU_mgv1a026126mg, partial... 76 3e-12 gb|AFS35559.1| ATP synthase CF1 beta subunit', partial (plastid)... 76 4e-12 gb|AGH25542.1| ATP synthase beta subunit, partial (chloroplast) ... 76 4e-12 emb|CAB94299.1| ATP synthase beta subunit, partial (chloroplast)... 76 7e-12 gb|AAM52119.1| ATP synthase beta subunit, partial (chloroplast) ... 76 8e-12 gb|AAT57691.1| ATP synthase beta chain, partial (chloroplast) [I... 74 9e-12 gb|ALO75645.1| ATP synthase beta subunit, partial (plastid) [Pho... 76 1e-11 gb|AEX31407.1| ATP synthase beta subunit, partial (plastid) [Tri... 75 1e-11 gb|AKR17196.1| ATP synthase beta subunit, partial (chloroplast) ... 76 1e-11 gb|AEX31437.1| ATP synthase beta subunit, partial (plastid) [Tri... 75 1e-11 gb|AEX31406.1| ATP synthase beta subunit, partial (plastid) [Tri... 75 1e-11 gb|AAT57687.1| ATP synthase beta chain, partial (chloroplast) [H... 74 1e-11 gb|AAT57688.1| ATP synthase beta chain, partial (chloroplast) [H... 74 1e-11 gb|AHZ11867.1| ATP synthase beta subunit, partial (chloroplast) ... 74 1e-11 >gb|ACZ72942.1| F1 ATPase beta subunit, partial [Corchorus capsularis] Length = 118 Score = 75.9 bits (185), Expect = 1e-12 Identities = 39/44 (88%), Positives = 39/44 (88%) Frame = -1 Query: 1781 PGARMRVGLTALIMAEYF*DVNEQDVLLFIDNNFRFVQTRSEVS 1650 PGARMRVGLTAL MAEYF DVNEQDVLLFIDN FRFVQ SEVS Sbjct: 2 PGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVS 45 >gb|KMS98665.1| hypothetical protein BVRB_3g069750 [Beta vulgaris subsp. vulgaris] Length = 136 Score = 75.9 bits (185), Expect = 2e-12 Identities = 39/44 (88%), Positives = 39/44 (88%) Frame = -1 Query: 1781 PGARMRVGLTALIMAEYF*DVNEQDVLLFIDNNFRFVQTRSEVS 1650 PGARMRVGLTAL MAEYF DVNEQDVLLFIDN FRFVQ SEVS Sbjct: 61 PGARMRVGLTALTMAEYFKDVNEQDVLLFIDNIFRFVQAGSEVS 104 >gb|PHT34495.1| ATP synthase subunit beta, chloroplastic [Capsicum baccatum] Length = 137 Score = 75.9 bits (185), Expect = 2e-12 Identities = 39/44 (88%), Positives = 39/44 (88%) Frame = -1 Query: 1781 PGARMRVGLTALIMAEYF*DVNEQDVLLFIDNNFRFVQTRSEVS 1650 PGARMRVGLTAL MAEYF DVNEQDVLLFIDN FRFVQ SEVS Sbjct: 5 PGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVS 48 >gb|PKA46425.1| ATP synthase subunit beta, chloroplastic [Apostasia shenzhenica] Length = 118 Score = 75.1 bits (183), Expect = 2e-12 Identities = 38/54 (70%), Positives = 43/54 (79%) Frame = -1 Query: 1781 PGARMRVGLTALIMAEYF*DVNEQDVLLFIDNNFRFVQTRSEVSVSCFPPLFNT 1620 PGARMRVGLTAL MAEYF DVNEQDVLLFIDN FRFVQ SE+ ++ + N+ Sbjct: 61 PGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEIIIALIARIPNS 114 >gb|OMP13146.1| hypothetical protein COLO4_02195 [Corchorus olitorius] Length = 147 Score = 75.9 bits (185), Expect = 3e-12 Identities = 39/44 (88%), Positives = 39/44 (88%) Frame = -1 Query: 1781 PGARMRVGLTALIMAEYF*DVNEQDVLLFIDNNFRFVQTRSEVS 1650 PGARMRVGLTAL MAEYF DVNEQDVLLFIDN FRFVQ SEVS Sbjct: 23 PGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVS 66 >gb|AAT57700.1| ATP synthase beta chain, partial (chloroplast) [Preissia quadrata] Length = 147 Score = 75.9 bits (185), Expect = 3e-12 Identities = 39/44 (88%), Positives = 39/44 (88%) Frame = -1 Query: 1781 PGARMRVGLTALIMAEYF*DVNEQDVLLFIDNNFRFVQTRSEVS 1650 PGARMRVGLTAL MAEYF DVNEQDVLLFIDN FRFVQ SEVS Sbjct: 83 PGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVS 126 >gb|EYU36961.1| hypothetical protein MIMGU_mgv1a026126mg, partial [Erythranthe guttata] Length = 151 Score = 75.9 bits (185), Expect = 3e-12 Identities = 39/44 (88%), Positives = 39/44 (88%) Frame = -1 Query: 1781 PGARMRVGLTALIMAEYF*DVNEQDVLLFIDNNFRFVQTRSEVS 1650 PGARMRVGLTAL MAEYF DVNEQDVLLFIDN FRFVQ SEVS Sbjct: 18 PGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVS 61 >gb|AFS35559.1| ATP synthase CF1 beta subunit', partial (plastid) [Fragaria pentaphylla] Length = 159 Score = 75.9 bits (185), Expect = 4e-12 Identities = 39/44 (88%), Positives = 39/44 (88%) Frame = -1 Query: 1781 PGARMRVGLTALIMAEYF*DVNEQDVLLFIDNNFRFVQTRSEVS 1650 PGARMRVGLTAL MAEYF DVNEQDVLLFIDN FRFVQ SEVS Sbjct: 16 PGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVS 59 >gb|AGH25542.1| ATP synthase beta subunit, partial (chloroplast) [Monarda citriodora] Length = 160 Score = 75.9 bits (185), Expect = 4e-12 Identities = 39/44 (88%), Positives = 39/44 (88%) Frame = -1 Query: 1781 PGARMRVGLTALIMAEYF*DVNEQDVLLFIDNNFRFVQTRSEVS 1650 PGARMRVGLTAL MAEYF DVNEQDVLLFIDN FRFVQ SEVS Sbjct: 20 PGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVS 63 >emb|CAB94299.1| ATP synthase beta subunit, partial (chloroplast) [Gnetum gnemon] Length = 186 Score = 75.9 bits (185), Expect = 7e-12 Identities = 39/44 (88%), Positives = 39/44 (88%) Frame = -1 Query: 1781 PGARMRVGLTALIMAEYF*DVNEQDVLLFIDNNFRFVQTRSEVS 1650 PGARMRVGLTAL MAEYF DVNEQDVLLFIDN FRFVQ SEVS Sbjct: 38 PGARMRVGLTALAMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVS 81 >gb|AAM52119.1| ATP synthase beta subunit, partial (chloroplast) [Paralepistemon shirensis] Length = 194 Score = 75.9 bits (185), Expect = 8e-12 Identities = 39/44 (88%), Positives = 39/44 (88%) Frame = -1 Query: 1781 PGARMRVGLTALIMAEYF*DVNEQDVLLFIDNNFRFVQTRSEVS 1650 PGARMRVGLTAL MAEYF DVNEQDVLLFIDN FRFVQ SEVS Sbjct: 36 PGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVS 79 >gb|AAT57691.1| ATP synthase beta chain, partial (chloroplast) [Isotachis lyallii] Length = 136 Score = 73.9 bits (180), Expect = 9e-12 Identities = 37/44 (84%), Positives = 39/44 (88%) Frame = -1 Query: 1781 PGARMRVGLTALIMAEYF*DVNEQDVLLFIDNNFRFVQTRSEVS 1650 PGARMRVGLTAL MAEYF D+N+QDVLLFIDN FRFVQ SEVS Sbjct: 83 PGARMRVGLTALTMAEYFRDINKQDVLLFIDNIFRFVQAGSEVS 126 >gb|ALO75645.1| ATP synthase beta subunit, partial (plastid) [Phoenix dactylifera] Length = 207 Score = 75.9 bits (185), Expect = 1e-11 Identities = 39/44 (88%), Positives = 39/44 (88%) Frame = -1 Query: 1781 PGARMRVGLTALIMAEYF*DVNEQDVLLFIDNNFRFVQTRSEVS 1650 PGARMRVGLTAL MAEYF DVNEQDVLLFIDN FRFVQ SEVS Sbjct: 160 PGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVS 203 >gb|AEX31407.1| ATP synthase beta subunit, partial (plastid) [Trithuria cowieana] Length = 166 Score = 74.7 bits (182), Expect = 1e-11 Identities = 38/44 (86%), Positives = 39/44 (88%) Frame = -1 Query: 1781 PGARMRVGLTALIMAEYF*DVNEQDVLLFIDNNFRFVQTRSEVS 1650 PGARMRVGLTAL MAEYF DVN+QDVLLFIDN FRFVQ SEVS Sbjct: 14 PGARMRVGLTALTMAEYFRDVNQQDVLLFIDNIFRFVQAGSEVS 57 >gb|AKR17196.1| ATP synthase beta subunit, partial (chloroplast) [Dioscorea pohlii] Length = 211 Score = 75.9 bits (185), Expect = 1e-11 Identities = 39/44 (88%), Positives = 39/44 (88%) Frame = -1 Query: 1781 PGARMRVGLTALIMAEYF*DVNEQDVLLFIDNNFRFVQTRSEVS 1650 PGARMRVGLTAL MAEYF DVNEQDVLLFIDN FRFVQ SEVS Sbjct: 60 PGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVS 103 >gb|AEX31437.1| ATP synthase beta subunit, partial (plastid) [Trithuria submersa] Length = 171 Score = 74.7 bits (182), Expect = 1e-11 Identities = 38/44 (86%), Positives = 39/44 (88%) Frame = -1 Query: 1781 PGARMRVGLTALIMAEYF*DVNEQDVLLFIDNNFRFVQTRSEVS 1650 PGARMRVGLTAL MAEYF DVN+QDVLLFIDN FRFVQ SEVS Sbjct: 19 PGARMRVGLTALTMAEYFRDVNQQDVLLFIDNIFRFVQAGSEVS 62 >gb|AEX31406.1| ATP synthase beta subunit, partial (plastid) [Trithuria cowieana] Length = 172 Score = 74.7 bits (182), Expect = 1e-11 Identities = 38/44 (86%), Positives = 39/44 (88%) Frame = -1 Query: 1781 PGARMRVGLTALIMAEYF*DVNEQDVLLFIDNNFRFVQTRSEVS 1650 PGARMRVGLTAL MAEYF DVN+QDVLLFIDN FRFVQ SEVS Sbjct: 20 PGARMRVGLTALTMAEYFRDVNQQDVLLFIDNIFRFVQAGSEVS 63 >gb|AAT57687.1| ATP synthase beta chain, partial (chloroplast) [Haplomitrium blumei] Length = 147 Score = 73.9 bits (180), Expect = 1e-11 Identities = 37/44 (84%), Positives = 39/44 (88%) Frame = -1 Query: 1781 PGARMRVGLTALIMAEYF*DVNEQDVLLFIDNNFRFVQTRSEVS 1650 PGARMRVGLTAL MAEYF D+N+QDVLLFIDN FRFVQ SEVS Sbjct: 83 PGARMRVGLTALTMAEYFRDINKQDVLLFIDNIFRFVQAGSEVS 126 >gb|AAT57688.1| ATP synthase beta chain, partial (chloroplast) [Haplomitrium gibbsiae] Length = 147 Score = 73.9 bits (180), Expect = 1e-11 Identities = 37/44 (84%), Positives = 39/44 (88%) Frame = -1 Query: 1781 PGARMRVGLTALIMAEYF*DVNEQDVLLFIDNNFRFVQTRSEVS 1650 PGARMRVGLTAL MAEYF D+N+QDVLLFIDN FRFVQ SEVS Sbjct: 83 PGARMRVGLTALTMAEYFRDINKQDVLLFIDNIFRFVQAGSEVS 126 >gb|AHZ11867.1| ATP synthase beta subunit, partial (chloroplast) [Radula complanata] Length = 148 Score = 73.9 bits (180), Expect = 1e-11 Identities = 37/44 (84%), Positives = 39/44 (88%) Frame = -1 Query: 1781 PGARMRVGLTALIMAEYF*DVNEQDVLLFIDNNFRFVQTRSEVS 1650 PGARMRVGLTAL MAEYF D+N+QDVLLFIDN FRFVQ SEVS Sbjct: 86 PGARMRVGLTALTMAEYFRDINKQDVLLFIDNIFRFVQAGSEVS 129