BLASTX nr result
ID: Ophiopogon27_contig00011025
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00011025 (398 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020255681.1| ethylene-responsive transcription factor RAP... 75 2e-13 >ref|XP_020255681.1| ethylene-responsive transcription factor RAP2-4-like [Asparagus officinalis] gb|ONK74013.1| uncharacterized protein A4U43_C03F1900 [Asparagus officinalis] Length = 320 Score = 75.5 bits (184), Expect = 2e-13 Identities = 42/93 (45%), Positives = 51/93 (54%) Frame = +1 Query: 118 FSPLQSHQNQIFDQPSPSRSNLLSLEQPDLSQLGPIGLAXXXXXXXXXXXXXXXXXXXXX 297 +SPL S QN FD SPS S+LLS++QPDLSQ+GP+GL Sbjct: 57 YSPLPSFQNPTFDHSSPSNSSLLSMDQPDLSQVGPVGLTQLSPLQIQQIQAQIQLNHQHQ 116 Query: 298 XXXSRALQARNFHHQSAVNYSSHLGVRPQPMKL 396 SR LQARN+H+ LGV+PQPMKL Sbjct: 117 LMVSRTLQARNYHNT--------LGVKPQPMKL 141