BLASTX nr result
ID: Ophiopogon27_contig00010827
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00010827 (713 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020267763.1| mitogen-activated protein kinase 15-like [As... 70 4e-10 >ref|XP_020267763.1| mitogen-activated protein kinase 15-like [Asparagus officinalis] gb|ONK68522.1| uncharacterized protein A4U43_C05F12800 [Asparagus officinalis] Length = 616 Score = 70.1 bits (170), Expect = 4e-10 Identities = 39/68 (57%), Positives = 42/68 (61%) Frame = -1 Query: 713 SFVHHLSETGGGEVINQSKPDRRIPNEVGILQATKPPPFSXXXXXXXXXXXAHHRKVGTV 534 S H S GG E I +SK D+RI NEV +LQATKPPPFS AHH GTV Sbjct: 552 SLFRHYSAAGGDEAIIKSKLDQRIANEVSMLQATKPPPFS---GRITAPSGAHHLNSGTV 608 Query: 533 QFGMTRMY 510 QFGMTRMY Sbjct: 609 QFGMTRMY 616